(data stored in ACNUC7421 zone)

EMBL: AP010803.RUVB

AP010803.RUVB        Location/Qualifiers
FT   CDS_pept        102099..103118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SJA_C1-01010"
FT                   /product="Holliday junction resolvasome helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94935"
FT                   /db_xref="GOA:D4YX53"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX53"
FT                   /protein_id="BAI94935.1"
FT                   /translation="MSEDRLISSTRRVEDADAALRPKSLAEFIGQQAARENLRIFIEAA
FT                   KGRGEALDHVLFFGPPGLGKTTLAQIVAREMGVGFRATSGPVIAKSGDLAALLTNLDEG
FT                   DVLFVDEIHRLNPAVEEVLYPAMEDRALDLMIGEGPSARSVRIDLPPFTLVGATTRQGL
FT                   LTTPLRDRFGIPVRLQFYTVDELELVVRRAARLLDLAITSDGAVEIARRSRGTPRIAGR
FT                   LLRRVRDFANVAGAAAVDAKVADAALTRLEVDHLGLDLMDRRYLTMIADIYRGGPVGVE
FT                   TLAAGLSEARDTIEEVIEPYLIQLGLIARTARGRCLNALGWKHLGLNPPSHVQDGLFD"
     atgagcgagg accgcctcat atcctccacc cgtcgcgtcg aggatgccga cgccgcgctg        60
     cggcccaagt cgctggcgga attcatcggc cagcaggcgg cgcgggaaaa tctgcgcatc       120
     ttcatcgagg ccgccaaggg ccgcggcgaa gcgctggacc atgtcctctt cttcggtccg       180
     ccgggcctgg gcaagacgac gctggcgcag atcgtcgccc gcgaaatggg cgtgggtttc       240
     cgcgccacgt ccggcccggt catcgccaag tcgggcgatc tggccgcgct gctcaccaat       300
     ctggacgagg gcgacgtgct gttcgtcgac gagatacacc ggctaaaccc ggcggtcgag       360
     gaagtgctct accccgccat ggaggaccgg gcgctggacc tgatgatcgg cgaaggcccg       420
     tccgcccggt cagtgcggat cgacctgccg cccttcaccc tggtcggcgc gaccacgcgg       480
     caggggctgc tgacgacgcc gctgcgcgac cgtttcggca ttccggtgcg gttgcaattc       540
     tacacggtcg atgaactgga actggtggtt cggcgcgccg cccggctgct ggacctcgcc       600
     atcacgtccg acggcgcggt ggagatcgcc cggcgctcgc gggggacgcc gcgcatcgcc       660
     ggacggttgc tgcgccgggt gcgcgacttc gccaatgtgg cgggcgcggc ggcggtggac       720
     gccaaggtgg ccgatgccgc gctgacccgg ctggaggtcg accatctcgg cctggacctg       780
     atggaccgcc gttatctcac catgatcgcg gacatctatc gcggcgggcc ggtgggtgtc       840
     gaaacgctgg ccgccggcct ttccgaagcg cgcgacacga tagaggaagt gatcgaaccc       900
     tatctcatcc agcttggcct gatcgcccgc accgcgcggg ggcgctgcct gaacgccctc       960
     ggctggaagc atttgggcct caatccccct tcccatgtcc aggatggatt gttcgactga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page