(data stored in ACNUC7421 zone)

EMBL: AP010803.RUVC

AP010803.RUVC        Location/Qualifiers
FT   CDS_pept        101735..102061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="SJA_C1-01000"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /note="putative endonuclease containing a URI domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94934"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX52"
FT                   /protein_id="BAI94934.1"
FT                   /translation="MKEPCVYILASQPYGTIYIGVTSNLLGRLHQHRTNGVPGFTGRYA
FT                   VHNLVRFEMCDTMEQAIRREKQLKRWHRQWKINLIETENPRWVDLAVGLGLPSLDQHQR
FT                   HDGC"
     atgaaggaac cgtgcgtcta tatcctcgcc agccagccct atggcacgat ctatattggg        60
     gtgacgtcga acctgctggg acgcttgcat cagcaccgca cgaacggcgt tccgggcttc       120
     accgggcgat atgccgtcca caatctcgtc cgtttcgaaa tgtgcgacac gatggagcaa       180
     gccatccgtc gggaaaagca gctcaagcgt tggcatcggc agtggaagat caatctgatc       240
     gaaaccgaaa atccgaggtg ggtcgatctg gcggttgggt tgggtttgcc ctctctggat       300
     cagcaccagc ggcacgatgg atgctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page