(data stored in SCRATCH zone)

EMBL: AP010803.SCO1

AP010803.SCO1        Location/Qualifiers
FT   CDS_pept        complement(55261..55917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sco1"
FT                   /locus_tag="SJA_C1-00560"
FT                   /product="uncharacterized protein Sco1"
FT                   /note="uncharacterized protein SCO1/SenC/PrrC, involved in
FT                   biogenesis of respiratory and photosynthetic systems"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94890"
FT                   /db_xref="GOA:D4YX08"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX08"
FT                   /protein_id="BAI94890.1"
FT                   /translation="MAGGAMNKALISLTLPFAALLAACNMGAGGNASSGDDSAQGDLHG
FT                   ASIGAPFTLTDQDGKKVRWDDFKGRYRLVYFGYTYCPDVCPVDLQRILQGFAKFEKAKP
FT                   ALAARVQPIFISVDPDRDTPAVLKTYVAAFHPRLIGLTGTPDEIAKVAKDFVVLYNKEE
FT                   AKGASGYLVSHSRTPYLFGGDGEPVALVPVDDPGTPDADEGDPAKVTAFLEKWVK"
     atggctggcg gcgccatgaa caaagcgctg atttcgctca ccctgccgtt cgccgccctg        60
     ctggcagcct gtaatatggg ggcgggaggc aatgcatcaa gcggcgacga cagcgcccag       120
     ggcgacctgc acggggccag catcggcgcg cccttcacgc tgaccgacca ggacggcaag       180
     aaggtgcgct gggacgattt caagggcagg taccggctgg tctatttcgg ctatacctat       240
     tgccccgacg tctgcccggt cgacctgcaa cgcatcctgc agggcttcgc gaaattcgag       300
     aaggcgaaac ccgccctggc ggccagggtc cagccgatct tcatcagcgt cgatccggat       360
     cgcgacacgc ccgccgtcct caagacctat gtcgcggcct tccacccgcg cctgatcggc       420
     ctgaccggca cgcccgacga aatcgccaag gtggcaaagg atttcgtggt cctctacaac       480
     aaggaagagg cgaagggcgc gagcggctat ctggtcagcc acagccgcac cccctatctt       540
     ttcggcggcg atggggagcc ggtcgcgctg gtgccggtgg acgatccggg aaccccggac       600
     gcggatgaag gcgatcccgc gaaggtgacg gccttcctcg aaaaatgggt gaagtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page