(data stored in SCRATCH zone)

EMBL: AP010803.SECD

AP010803.SECD        Location/Qualifiers
FT   CDS_pept        597926..599527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="SJA_C1-05880"
FT                   /product="preprotein translocase SecD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95422"
FT                   /db_xref="GOA:D4YYJ0"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ0"
FT                   /protein_id="BAI95422.1"
FT                   /translation="MLNFPRWAVVAILLPLLIGIACAVPSFLPDSVVGQLPKFMQTRVN
FT                   LGLDLSGGSHLLLEASTQDVAKQRIANMEEQVRTELRRGDTKIAIGDISSRDGKLSFMV
FT                   RNPSQVDAAVERIRPLTQGAGLTGQRDFNVEVVNSSTIVITPTKAGIDNAVKGAMEVAT
FT                   EVIRKRIDEMGTREPTIQQQGDNRIVVQVPGLQDPKALKDLLGQTAKLEFKLVDVNANP
FT                   AEVAQGRAPVGSEVLPYPTNPAGPPVIAVYRQVMVSGEDLTDAQQGYDQTGNQPIVNIR
FT                   FNGAGGRKFGQVTSQNVNRPFAIILDGQVLSAPNINEPILGGSAQISGSFTVESANQLA
FT                   IALRSGKLPVALTVVEERTVGPQLGADSIRAGLMASVIAVAAVAAFMFVSYGRFGMYAN
FT                   LAVAINVLVILGVMGILGATLTLPGIAGFVLTIGTAVDANVLIYERIREERRRGRGVVQ
FT                   AIEHGYKEASRTIFEANVTHAIAGGIMLALGSGPVKGFAIVLLIGIATSVFTAVTFTRL
FT                   LVSRWVRAKRPTEIHI"
     atgctgaact tccctcgctg ggctgtcgtc gcgatcctgc tgccgctgct gatcggcata        60
     gcctgcgccg tgccgagctt cctgccggat tcggtggtcg ggcaattgcc caaattcatg       120
     cagacccgcg tgaacctggg cctcgacctg tcgggcggca gccacctgct gctcgaagcc       180
     tcgacccagg acgtggcgaa gcagcgcatc gccaatatgg aggagcaggt ccgcacggaa       240
     ctgcgccggg gcgacaccaa gatcgcgatc ggcgacattt ccagccgcga cgggaaattg       300
     agcttcatgg tgcgcaaccc gtcgcaggtc gacgccgccg tggagcgcat ccggccgctg       360
     acccagggtg cgggcctcac cggccagcgc gatttcaatg tggaggtggt gaacagctcc       420
     accatcgtca tcaccccgac caaggcgggc atcgacaatg cggtgaaggg cgcgatggaa       480
     gtcgcgacgg aggtgatccg caagcgcatc gacgaaatgg gcacgcgcga accgaccatc       540
     cagcagcagg gcgacaaccg catcgtcgtg caggtgccgg gccttcagga ccccaaggcg       600
     ctcaaggacc tgctcggcca gaccgccaag ctggaattca agctggtcga cgtcaacgcc       660
     aacccggcgg aagtcgcgca gggccgcgcg ccggtcggca gcgaagttct gccctacccg       720
     accaaccccg ccggaccgcc ggtgatcgcc gtctaccggc aggtcatggt gtcgggcgaa       780
     gacctgaccg acgcgcagca gggctatgac cagaccggca accagccgat cgtcaacatc       840
     cgcttcaacg gtgcgggcgg gcgcaaattc ggccaggtga cgtcgcagaa cgtcaaccgc       900
     cccttcgcca tcatcctgga cggccaggtg ctgtccgccc ccaacatcaa cgaaccgatc       960
     ctgggcggca gcgcgcagat cagcggcagc ttcacggtgg aaagcgccaa ccagctcgcc      1020
     atcgcgctgc gctccggcaa gctgcccgtc gcgctgaccg tggtggagga acgcacggtc      1080
     gggccgcagc ttggcgccga ttcgatccgc gccggcctga tggcctcggt catcgccgtc      1140
     gccgccgtcg ccgccttcat gttcgtcagc tacggccgct tcggcatgta cgccaacctc      1200
     gccgtcgcca tcaacgtgct ggtgatcctg ggcgtgatgg gcatattggg cgcgacgctg      1260
     acgctgccgg gcattgccgg cttcgtgctg accatcggca cggcggtcga cgccaacgtg      1320
     ctgatctacg aacgcatccg cgaggagcgg cggcgcggcc gcggggtcgt gcaggcgatc      1380
     gaacatggct ataaggaagc cagccgcacc atcttcgagg caaatgtgac ccacgccatc      1440
     gccggcggca tcatgctcgc tctggggtcg ggtccggtca agggcttcgc gatcgtgctg      1500
     ctcatcggca tcgcgaccag cgtgttcacc gccgtcacct tcacgcgcct gctggtgtcg      1560
     cgttgggtcc gcgccaagcg cccgaccgaa atccacatct ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page