(data stored in ACNUC7421 zone)

EMBL: AP010803.SECF

AP010803.SECF        Location/Qualifiers
FT   CDS_pept        599543..600529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="SJA_C1-05890"
FT                   /product="preprotein translocase SecF subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95423"
FT                   /db_xref="GOA:D4YYJ1"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ1"
FT                   /protein_id="BAI95423.1"
FT                   /translation="MKLLKLVPDNTNIGFVKLRHWAFALTALLTVLAVGATFYKGLNLG
FT                   VDFVGGLMIEAKFETPPQTDRVRSVIDRLGVGDGSLQQFGDPKTVQIRLPLPEQGGAGA
FT                   ANAIVEKARKAMTAEFPGVTFSRYDTVSGKVSGELIQNGVLAVMLAVIGIAIFSWFRYE
FT                   WQFGVSTFVAIMHDVLMTLGFFAVTQLEFDLNIVAAVLTIVGYSINDKMVIDDRIRENM
FT                   RKYRKMDMKSLIDLSVNETLPRTVMTSVTVLLALGALLLLGGHVLRGFTAAMMLGIIVG
FT                   TYSSVYVSSSLLISLGLSPATAEKKASKANIAAQAERMGPRDDGARP"
     atgaaactgc ttaagctcgt cccggacaac accaatatcg gcttcgtcaa gctgcgccac        60
     tgggcctttg ccctgacggc gctgctgacg gtgctggcgg tcggcgcgac cttttacaag       120
     gggttgaacc tgggcgtcga cttcgtcggc ggcctgatga tagaggcgaa gttcgaaacg       180
     ccgccgcaga ccgacagggt gcgcagcgtg atcgaccggc tgggcgtggg cgacggctcg       240
     ctccagcagt tcggcgatcc gaaaacggtg cagatccgcc tgcctctgcc ggaacagggc       300
     ggcgcgggcg cggccaacgc catcgtcgaa aaggcgcgca aggcgatgac ggccgaattc       360
     cccggcgtca ccttttcccg ctacgacacg gtgtcgggca aggtgtcggg cgaactgatc       420
     cagaacggcg tgctggcggt gatgctggcg gtgatcggca tcgcgatctt ctcctggttc       480
     cgctacgaat ggcagttcgg cgtctcgacc ttcgtcgcga tcatgcacga cgtgctgatg       540
     acgctgggct tcttcgccgt cacccagctg gaattcgacc tcaacatcgt cgccgccgtg       600
     ctgaccatcg tgggctattc gatcaacgac aagatggtga tcgacgaccg catccgcgaa       660
     aatatgcgca aatatcgcaa gatggacatg aagtcgctga tcgacctgtc ggtcaacgaa       720
     acgctgccgc gcacggtcat gacctccgtc accgtgctgc tggcgctggg cgcgctgctg       780
     ctgctgggcg gccatgtgct gcgcggcttc acggccgcca tgatgctggg catcatcgtc       840
     ggcacctatt cgtcggtcta tgtctcctcc tcgctgctga tcagcctggg cctgtccccc       900
     gccacggcgg agaagaaggc gagcaaggcc aatatcgccg cccaggccga gcggatgggc       960
     ccgcgcgacg acggggcgcg gccctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page