(data stored in ACNUC7421 zone)

EMBL: AP010803.SECY

AP010803.SECY        Location/Qualifiers
FT   CDS_pept        653277..654641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SJA_C1-06470"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95481"
FT                   /db_xref="GOA:D4YYP9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP9"
FT                   /protein_id="BAI95481.1"
FT                   /translation="MASRADQLASNLSLAKFSQATDLKKRLWFTLGALIVFRFLSFVPL
FT                   PGVDPTALSQLYAQTNGGILDIFNTFSGGSLSRMSLIALGVMPYITASIVVQLAASLSP
FT                   QLAAIKKEGESGRKKLNQYTRYGTVGLTAVQGYFIAVGLESFGAQSGVQAVVDPGYLFR
FT                   VAAVVSLIGGTMFLMWLGEQITSRGIGNGVSLIIMAGIVAQLPVTLSNLFKSSSTGAIS
FT                   GLVIFLVIVLGFGLIAFICFMERAQRRVLIQYPKRQTRQGLMQADRSHLPLKVNTAGVI
FT                   PPIFASSLLLMPLTVSQFAGQTVAGESRLGDFVLTLNQYLSHGSPVYMALYGLGIVFFC
FT                   FFYTAVVFNPEETADNLKRNGGFIPGIRPGKNTENYLDYVLTRITVIGAAYLAFICLVP
FT                   EFAIARAGIPFYLGGTSLLIVVNVTVDTVTQIQSHLLAHQYGDLIKKAKLKGRLR"
     atggcatcga gagccgacca gctcgcatcc aatctcagcc tggcgaagtt cagccaggcg        60
     accgacctca agaagcgcct gtggttcacg ctgggcgcgc tgatcgtctt ccgcttcctg       120
     agcttcgtgc cgctgccggg cgtcgatccg accgccctgt cgcagctcta cgcgcagacc       180
     aatggcggca tcctcgacat cttcaacacc ttttcgggcg gatcgctctc ccgcatgagc       240
     ctgatcgctc tgggggtgat gccctatatc accgcgtcca tcgtggtgca gcttgccgcc       300
     agcctctcgc cgcaactcgc ggcgatcaag aaggaaggcg aaagcggccg caagaagctc       360
     aatcaataca cccgttacgg cacggtcggc ctgaccgccg tgcagggcta tttcatcgcc       420
     gtggggctgg agagcttcgg cgcgcaatcg ggcgtgcagg cggtggtcga ccctggctat       480
     ctgttccggg tcgcggcggt ggtctcgctg atcggcggga ccatgttcct gatgtggctg       540
     ggcgaacaga tcacgtcgcg cgggatcggc aacggcgtgt cgctcatcat catggcgggc       600
     atcgtcgcgc aattgccggt gacgctgagc aacctgttca agtcgagcag cacgggcgcg       660
     atttccggcc tggtgatctt cctggtgatc gtgctgggct tcggcctcat cgccttcatc       720
     tgcttcatgg agcgggcgca gcgccgggtg ctgatccaat atcccaagcg ccagacgcgg       780
     cagggcctga tgcaggcgga ccgcagccat ttgccgctga aggtcaatac cgcgggcgtg       840
     atcccgccga tcttcgcttc gtcgctgctg ctgatgccgc tcaccgtctc gcaattcgcc       900
     ggccagaccg tggcgggcga gagcaggctc ggcgatttcg tgctgacgct gaaccagtat       960
     ctgtcgcacg gcagcccggt ctatatggcg ctgtacggcc ttggcatcgt cttcttctgc      1020
     ttcttctaca ccgccgtggt gttcaatccg gaagaaacgg ccgacaatct caagcgcaac      1080
     ggcggcttca ttcccggcat ccgcccgggc aagaacaccg aaaattatct ggattatgtg      1140
     ctgacgcgca tcacggtgat cggcgcggcc tatctggcct tcatctgcct ggtgccggaa      1200
     ttcgccatcg cccgggcggg cattcccttc taccttggtg ggactagcct gttgatcgtc      1260
     gtcaatgtta cggtcgacac cgtgacgcag atccagagcc acctgctcgc ccatcaatat      1320
     ggggatctga tcaagaaggc gaagctgaag gggcgtctgc gctaa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page