(data stored in ACNUC7421 zone)

EMBL: AP010803.SMC

AP010803.SMC         Location/Qualifiers
FT   CDS_pept        89845..93288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="SJA_C1-00910"
FT                   /product="chromosome segregation protein"
FT                   /note="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94925"
FT                   /db_xref="GOA:D4YX43"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX43"
FT                   /protein_id="BAI94925.1"
FT                   /translation="MQIKRLKLSGFKSFVDPTELRIEPGLTGIVGPNGCGKSNLLEAIR
FT                   WVMGESSAKSMRGGGMEDVIFAGTSTRPQRDFAEVSLLTVQEQGELFNAVEVAADGELE
FT                   VTRRIERGAGSAYRANGRDVRAKDVSLIFADAATGPHSPALVSQGRIAAVIAARPQERR
FT                   AMLEEAAGISGLHVRRKDAEQKLRAAEANLMRLDEILSDMDARANSLRRQAKAAERYIR
FT                   LSEQIRIAEARVIFARWREAAASADAARAEAKQAESAVAAAQEAQQAAAVHANAAVETL
FT                   ARKRAAAQAARDAASEAGHKLAALRTERDGAVRRLHDLAQQAARLEEDREREGTLANDA
FT                   AEAIARLTDEIAALKARIAQTESMRPDFAGRIARAEDAARDAELDLARAMAKQAGEQAE
FT                   LRVAEAALAAARSRLDRASREAQRLEAEAAALPDATPLEGKRAEALAAQQQAGADRDAA
FT                   EAAIRSAETSRAEAAEARAVAEAALSSARATLAALDSEAAALRRAVDSGTGNRSRALDR
FT                   LKAAPGYERALAAALGDDLEAPIAAEGKRRWTGAAALASDPPLPEGCTALSAHVSAPPE
FT                   LARRLAQVAVADGDEGQALAVGQRLVTRDGQLRRWDGYVAIEGGAAAAERLIRLNRLEA
FT                   IAAARPAAEAEVETARAAQDAASGREREAGQTLAAGRARLADADQRLRTALRAADEAAT
FT                   ALERLSGRREAIEERLSEARADLHAAQAEHDKAQAGRAAMPDGEETRAQVAALQQGSEK
FT                   ARLAVSQLQADQALADRALASDRERVAAADAEARGWRARAGEAAKRIAAMVERGEAIAK
FT                   ERAEIADQPDSLAAAIAALSEQGDTLTQAADTARREESEAEAALRTAEQRAAQAGEALA
FT                   TAREARATAAARAEAADEKRVETNRLSGERFECPPPVLPEKLGFASADIRIAQSEQAEH
FT                   DRLVTERERIGPVNLVAAQELEELEATQANSRAESEELSQAINRLRGSIGSLNREGRQR
FT                   LLAAFEAVDGHFRRLFTTLFNGGQAHLELIDSDDPLEAGLEIMAQPPGKKLAALTLLSG
FT                   GEQALTAVALIFGLFLTNPAPICVLDEVDAPLDDANVERFCDLLDAMVAQTDTRYLIVS
FT                   HNAVTMARMHRLFGVTMVERGVSRLVSVNLGGAEALLAAE"
     atgcagataa agcgcctcaa gctctccggc ttcaagagct tcgtcgaccc gacggagctg        60
     cgcatcgagc ccggccttac cggcatcgtc gggccgaacg gctgcggcaa gtcgaacctg       120
     ctggaagcga tccgctgggt catgggcgaa tccagcgcca agtcgatgcg tggcggcggc       180
     atggaggatg tgatcttcgc gggcacctcc acccgcccgc agcgcgattt cgcggaagtc       240
     tcgctgctca ccgtgcagga gcagggggaa ctgttcaacg cggtggaggt cgccgccgac       300
     ggggaactgg aagtcactcg ccggatcgag cgcggggcgg gcagcgccta tcgcgccaat       360
     ggccgcgacg tccgggcgaa ggacgtgtcg ctgatcttcg ccgacgccgc caccggcccg       420
     catagcccgg ctctggtcag tcaggggcgc atcgccgccg tgatcgccgc ccgtccgcag       480
     gaacgccgcg ccatgctgga ggaggcggcg ggcatttccg gcctgcacgt tcggcgcaag       540
     gatgccgaac agaagctgcg cgccgccgaa gcgaatctga tgcggctgga cgaaatcctc       600
     tccgacatgg atgcccgcgc caacagcctg cgccgtcagg ccaaggcggc ggagcgctat       660
     atccgcctgt cggagcagat ccgcattgcc gaggcgcggg tgatcttcgc tcgctggcgc       720
     gaggcggccg ccagcgcgga cgccgcccgc gccgaggcga agcaggccga aagcgccgtc       780
     gccgccgcgc aggaggcgca gcaggccgcc gctgtccatg ccaatgccgc cgtcgaaacg       840
     cttgcgcgga agcgcgccgc cgcccaggca gcacgcgacg ccgccagcga agcgggccac       900
     aagctcgccg cgctgcgcac cgagcgcgat ggcgcggtcc gccgcctcca tgacctcgcc       960
     cagcaggccg cccggctgga agaggacagg gagcgggagg gcacgctcgc caacgacgcg      1020
     gcggaggcga tcgcccgcct caccgacgaa atcgccgcgc tcaaggcgcg catcgcgcaa      1080
     accgaatcga tgcgtcccga tttcgccggg cgcatcgccc gcgccgagga tgccgcccgc      1140
     gacgccgaac tcgatctggc cagggcgatg gcgaagcagg cgggcgagca ggcggaactg      1200
     cgcgtggccg aggctgcgct ggccgctgcg cgcagccgcc tcgaccgcgc atcccgcgag      1260
     gcgcagcggc tggaggccga agccgccgcg ctgcccgacg caacgccgct ggaagggaag      1320
     cgggccgagg cgctcgccgc gcagcagcag gccggtgcgg atcgcgacgc ggccgaagcc      1380
     gcgatccgct ccgccgagac cagccgcgcc gaggctgccg aggcgcgggc cgtcgccgaa      1440
     gccgccttgt cgtccgcccg cgccaccctt gccgccctgg atagcgaagc cgccgcgctc      1500
     cggcgcgccg tcgacagcgg cacgggcaat cgaagtcggg cactcgaccg gctgaaggcg      1560
     gctcccggct atgaacgcgc tctcgcggcg gcgctggggg acgatctgga agcgcccatc      1620
     gcggccgaag gcaagcggcg atggaccggc gccgccgcgc tcgccagcga cccgcccttg      1680
     cccgaaggct gcaccgccct ttccgcccat gtatccgcgc cgcccgaact tgcccgccgc      1740
     ctggcgcagg tcgcggtcgc ggatggagac gaaggccagg cccttgcggt cggccagcgg      1800
     ctcgtcacca gggacgggca gcttcgccgt tgggacggct atgtcgccat agagggcggg      1860
     gccgcggccg ccgagcggtt gatccggctc aaccgcctgg aagccattgc cgccgcccgg      1920
     cccgccgccg aagccgaggt cgagactgcc cgcgccgcgc aggacgccgc ttcgggacgc      1980
     gagcgggagg ctggccagac gctggctgcc ggccgcgccc ggcttgcgga tgcggaccag      2040
     cggctgcgca ccgccctgcg cgccgccgac gaggccgcca ccgcgctgga gcggctgagc      2100
     gggcgccgag aggcgataga ggaacggttg agcgaagccc gcgccgacct gcatgccgcg      2160
     caggccgagc atgacaaggc gcaggccggc cgcgccgcca tgcccgatgg cgaggaaacc      2220
     cgcgcccagg tcgccgcgct gcagcagggg agcgagaagg cccggctggc cgtcagccag      2280
     ctacaggccg atcaggctct ggccgaccgc gcattggcca gcgaccgcga gcgcgtggcc      2340
     gccgccgacg cggaggccag gggctggcgc gcccgcgccg gcgaagcggc caagcgcatc      2400
     gccgccatgg tcgagcgcgg cgaggccata gcgaaggaac gggccgagat cgcggaccag      2460
     ccggacagcc tggccgccgc catcgccgct ttgagcgagc agggcgatac attgacgcag      2520
     gccgcagaca ccgcccgccg cgaggaaagc gaagccgaag ccgcgctccg caccgccgaa      2580
     cagcgcgcag cccaggcggg cgaagcgctc gccaccgccc gcgaagcgcg cgccaccgcc      2640
     gccgctcgcg ccgaggccgc cgatgagaag cgggtcgaaa ccaaccgcct ttccggcgaa      2700
     cgtttcgagt gcccgccgcc ggtcctgccg gaaaaactgg gtttcgccag cgccgacatc      2760
     cgcatcgccc agagcgaaca ggccgaacat gaccggctcg tcaccgagcg ggagcgcatc      2820
     ggccctgtca acctcgtcgc cgcgcaggaa ctggaggagc tggaagcgac ccaggccaac      2880
     agccgcgccg aaagcgagga actgagccag gcgatcaacc gcctgcgcgg ctccatcggc      2940
     agcttgaaca gggaggggcg gcaacgcctg ctcgccgcgt tcgaggcggt ggacgggcat      3000
     ttccgccgcc tgttcaccac cctgttcaac ggcggccagg cgcatctgga actgatcgac      3060
     agcgacgatc cgctggaggc gggtctggag atcatggccc agccgccggg caagaagctc      3120
     gccgccctga ccctgctttc cggcggcgag caggcgctga ccgccgtcgc cctgatcttc      3180
     ggactgttcc tgacgaaccc cgcgccgatc tgcgtcctgg atgaagtcga cgcgccgctg      3240
     gacgacgcca atgtcgaacg cttctgcgac ctgctcgacg ccatggtggc gcagaccgac      3300
     acgcgatacc tcatcgtcag ccataatgcg gtgacgatgg cccgcatgca ccggctgttc      3360
     ggcgtgacca tggtggaacg gggcgtcagt cggctggttt cggtcaatct gggcggcgcg      3420
     gaggcccttc tggcagcgga gtag                                             3444
//

If you have problems or comments...

PBIL Back to PBIL home page