(data stored in ACNUC7421 zone)

EMBL: AP010803.SSB

AP010803.SSB         Location/Qualifiers
FT   CDS_pept        315507..316064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="SJA_C1-02990"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95133"
FT                   /db_xref="GOA:D4YXQ1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ1"
FT                   /protein_id="BAI95133.1"
FT                   /translation="MAGSVNKVILVGNLGADPEVKSFQNGGKVCNLRIATSESWKDRMS
FT                   GERKERTEWHSVAIFSEGLAGVAERFLRKGSKVYLEGQLRTRKWQDQSGNDRYTTEVVL
FT                   QGPGAVLTMLDGAPGGGGQGGGGRSQGGGDWSGGSSGFGGGDYDDFGGGGFGGGSGRSS
FT                   GGGRGSAGGPNFDNDLDDEVPF"
     atggcgggtt cggtcaacaa ggtcattctg gtcggcaatc tgggcgccga cccggaggtc        60
     aagagctttc agaatggcgg gaaggtgtgc aacctgcgga tcgcgacctc cgaaagctgg       120
     aaggaccgca tgtcgggcga gcgcaaggag cgcaccgaat ggcacagcgt ggcgatcttc       180
     tccgaagggc tggccggcgt ggccgaacgc ttcctgcgca aggggtcgaa agtctatctg       240
     gagggccagc tccgcacccg caaatggcag gaccagtcgg gcaatgaccg ctacaccacc       300
     gaagtggtgc tgcagggtcc gggcgcggtg ctgaccatgc ttgacggcgc gccgggcggc       360
     ggcggccagg gcggcggtgg ccgctcccag ggcggcggcg actggagcgg cgggtcgagc       420
     ggctttggcg gcggcgatta tgacgatttc ggcggcggcg gcttcggcgg cggttccggc       480
     cgctcctccg gcggcgggcg cggcagcgcg ggcgggccga atttcgacaa tgacctggac       540
     gatgaagtgc cgttctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page