(data stored in SCRATCH zone)

EMBL: AP010803.STBE

AP010803.STBE        Location/Qualifiers
FT   CDS_pept        complement(508098..508379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbE"
FT                   /gene_synonym="relE"
FT                   /locus_tag="SJA_C1-05010"
FT                   /product="StbE/RelE-family protein"
FT                   /note="plasmid stabilization system / addiction module
FT                   toxin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95335"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA3"
FT                   /protein_id="BAI95335.1"
FT                   /translation="MRTIERFGRFKRDYKREKKGQHAKTLDADLIPIIEALASDEPLEP
FT                   RHRDHALTGDWRDHRDCHIKPDLVLIYRKPDDDTLQLVRLGSHAELGW"
     atgcggacga ttgaacgctt cgggcggttc aagcgcgact acaagcggga gaagaagggg        60
     cagcacgcca agacgctgga cgctgacctg atcccgatca tcgaggcgct ggcatccgac       120
     gagccgcttg aaccgcgcca ccgcgaccat gcgctgaccg gcgactggcg cgaccatcgc       180
     gattgccaca taaagcccga cctcgtgctg atttaccgca agcccgatga cgacaccttg       240
     cagcttgtgc gcttgggatc gcacgcggaa ttgggttggt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page