(data stored in ACNUC7421 zone)

EMBL: AP010803.TERC

AP010803.TERC        Location/Qualifiers
FT   CDS_pept        complement(34791..35510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="SJA_C1-00350"
FT                   /product="tellurite resistance protein TerC"
FT                   /note="membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94869"
FT                   /db_xref="GOA:D4YWY7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY7"
FT                   /protein_id="BAI94869.1"
FT                   /translation="MIDLIATAAAAAQGIGSPADIWAHIVNDFSNIGSPAALAAFGQVL
FT                   MIDVLLAGDNAIVVGALAAGLPAEQRKRVILIGIIAALVLRIGFALVVTQLMQIVGLIL
FT                   AGGLLLLWVAFKMWRELHPKRGGDTPDTGDDDISGLRPAKSFAGAAWAVAVADVSMSLD
FT                   NVLAVAGAARDHPGILIIGLILSVALMGIAANIIAKYIERFRWIAYLGLAVIVYVAVKM
FT                   IYDGVVDHQVGILTLFV"
     atgatcgacc taatcgcaac cgccgcagcg gcggctcagg ggatcggctc gcccgccgac        60
     atctgggcgc atatcgtcaa tgatttcagc aatatcggct cgcccgccgc gctggctgcg       120
     ttcggccagg tgctgatgat cgacgtgctg ctcgccgggg acaacgccat cgtcgtcggc       180
     gcgctggcgg cggggcttcc ggcggagcag cgcaagaggg tcatattgat cggcatcatc       240
     gccgcgctgg tcctgcgcat cggcttcgcg ctggtggtga cgcagttgat gcagatcgtg       300
     ggcctgatcc tggcgggcgg gctgctgctg ctgtgggtcg cgttcaagat gtggcgcgaa       360
     ctgcacccga agcggggcgg ggacacgccg gacaccggcg acgacgacat atccggcctg       420
     cgccccgcca agagcttcgc gggcgcggcc tgggcggtcg cggtggcgga cgtttcgatg       480
     agcctggaca atgtgctggc ggtggccggc gcggcccgcg accatccggg catcctgatc       540
     atcggcctga tcctgtctgt cgcgctgatg ggcatcgccg cgaacatcat cgccaaatat       600
     atcgaacgct tccgctggat cgcctatctg ggcctggccg tgatcgtcta tgtcgcggtc       660
     aagatgatct atgacggcgt cgtggatcat caggtcggca tattgacgct cttcgtctag       720
//

If you have problems or comments...

PBIL Back to PBIL home page