(data stored in ACNUC7421 zone)

EMBL: AP010803.THIL

AP010803.THIL        Location/Qualifiers
FT   CDS_pept        complement(293833..294747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="SJA_C1-02770"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95111"
FT                   /db_xref="GOA:D4YXM9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXM9"
FT                   /protein_id="BAI95111.1"
FT                   /translation="MSAESRFLTLLRLLANDPAAQGLRDDVAVLEVGGARLILTSDTMV
FT                   EGVHHLPADPPADIGWKLAAVNLSDLAAKGAKPLGCLLNYALSGDESWDAAFLEGLGEA
FT                   LARHAMPLLGGDTVQMPRGAPRSYSLTALGEATGPVPLRGGAKAGDRLYLTGPVGDAGI
FT                   GLELLQTMPRASGPLVDAYRRPRPRLAEGALLAPHVHAMMDVSDGLLIDAARMAEASGL
FT                   AVTIDHIPLSPALEATRGASNAVQIAAARAGDDYELLFALPAAVKPPVRAIPVGRFAKG
FT                   GGLTLKIDGVAIPLPDRLGWEHG"
     atgtccgctg aatcccgttt cctgaccctg ctccgcctgc tggcgaacga ccccgccgct        60
     cagggcctgc gggacgatgt ggcggtgctg gaagtcggcg gcgcccggct gatcctgacc       120
     agcgacacga tggtggaggg ggtgcatcat ctccccgccg atccgcccgc cgacatcggc       180
     tggaagctcg ccgccgtgaa cctctccgac cttgcggcca agggcgcgaa gccgctcggt       240
     tgcctgctca actatgcgct gtccggcgat gaatcctggg acgccgcctt cctcgaaggg       300
     ctgggcgagg cgctggcgcg tcacgccatg cctttgctgg gcggcgacac ggtgcagatg       360
     ccgcgtggcg cgccgcgcag ctacagcctg accgcgctgg gcgaagcgac cggccccgtc       420
     cccctgcgcg gcggcgcgaa ggcgggggac aggctctatc tgaccggccc ggtgggcgat       480
     gcgggcatcg gcctggagct gctgcaaacc atgccccgcg catccggccc gctggtcgac       540
     gcctatcgcc gcccgcgccc gcgcctggcc gaaggggcgc tgctcgcgcc gcacgtccat       600
     gcgatgatgg acgtgtcgga cggcctgctg atcgacgccg cccgcatggc ggaggcaagc       660
     gggctggcgg tcaccatcga ccatatcccc ctctcccccg cgctggaggc cacgcggggc       720
     gccagcaacg cggtccagat cgcggcggcg cgggccgggg acgattatga actgctcttc       780
     gccctgcccg ccgcggtcaa gccgcccgtg cgcgccatcc ccgtcggccg cttcgccaag       840
     ggcggggggc tgacgctgaa gatcgacggc gtggcgatcc cgctgccgga ccggctcggc       900
     tgggaacatg gctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page