(data stored in ACNUC7421 zone)

EMBL: AP010803.TNPR

AP010803.TNPR        Location/Qualifiers
FT   CDS_pept        505239..505847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="SJA_C1-04980"
FT                   /product="resolvase"
FT                   /note="invertase/recombinase like protein / site-specific
FT                   recombinase, DNA invertase Pin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95332"
FT                   /db_xref="GOA:D4YYA0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA0"
FT                   /protein_id="BAI95332.1"
FT                   /translation="MAIRTRSQNDGKTDTIGQHVALIGYARVSTADQKLALQLDALSAA
FT                   GCDRIFDDYASGAKADRPGLAEALTYLRTGDTLVVWKLDRLGRSMSHLIEKVGELAARG
FT                   VGFRSLTEQIDTTTSGGMLVFNIFGSLAQFERDLIRERTHAGLRAARERGSQGGRRPVV
FT                   TPDKLRKARAHIAAGLTVREAAARLKIGKTALYKALESA"
     atggcgattc ggacaagatc gcaaaatgat gggaaaacgg acacgatcgg gcagcatgtg        60
     gcgctgatcg gctatgcgcg cgtctcgacc gcagaccaga agctggcgct ccagctcgac       120
     gcgttgagcg ctgccggttg cgatcgcata ttcgacgatt atgcatctgg agcaaaagcc       180
     gatcggcccg gcctggccga ggcgctcacc tatctgcgta ccggcgacac gctggtggtc       240
     tggaaactcg atcgtcttgg gcgttcgatg agccacctga tcgagaaagt cggcgagctg       300
     gcggcgcgcg gcgtgggttt ccgctcgctc accgagcaga tcgataccac cacgtcaggc       360
     gggatgctgg tattcaacat cttcggctcg cttgcccaat tcgagcgcga tctgatccgg       420
     gaacgcaccc atgctggcct gcgagccgcg cgcgagcgcg gtagtcaggg cggtcgccgc       480
     cctgtcgtca ctcccgacaa gctgcgcaag gcgcgggcgc acatcgcagc gggcctaact       540
     gttcgtgagg cggcggctcg gctcaagatc gggaaaaccg ccctgtacaa ggctctggaa       600
     agcgcatga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page