(data stored in ACNUC7421 zone)

EMBL: AP010803.TONB

AP010803.TONB        Location/Qualifiers
FT   CDS_pept        306570..307259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="SJA_C1-02890"
FT                   /product="TonB-like protein"
FT                   /note="periplasmic protein TonB, links inner and outer
FT                   membranes"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95123"
FT                   /db_xref="GOA:D4YXP1"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP1"
FT                   /protein_id="BAI95123.1"
FT                   /translation="MQWISTGAAGGETISGYSGGRRSPIGIGGAVAVHALVFGAYLLMP
FT                   KEVIDTFRSSPFTTYAVPETPPPPPEEAAPETDSKIPPKARSQPTTVSDPIVDTVIKGG
FT                   FTAKADDHPTGDSGTGTITPPIIPPLPEPVLAEASIDPRALAAFQPDYPGAMIRQGMEG
FT                   KVVVRVTIGPDGRVIDIERLSAADEAFWIATQRHALRKWRFRPATRDGVPVSSTKVLTV
FT                   HFRLADV"
     atgcagtgga tcagcacggg tgcggcaggc ggcgagacca tttccggtta tagcggcggc        60
     aggcgttccc ccatcggcat aggcggcgcg gtggccgtgc atgcgctggt gtttggcgcc       120
     tatcttctga tgcccaagga ggtgatcgac accttccgca gctctccgtt cacgacctat       180
     gccgtccccg aaacgccccc gccgccgccc gaagaagcgg ccccggaaac ggacagcaaa       240
     atcccgccca aggcccgttc gcaaccgacc accgtctccg accccatcgt cgacacggtc       300
     atcaagggcg gcttcacggc gaaggccgac gatcatccca ccggagattc cggcacgggc       360
     acgatcactc cgcccatcat cccgccgctt cccgaacccg tcctggcgga ggccagcatc       420
     gatccccgcg cgctggcggc gttccagccc gactatcccg gcgcgatgat ccggcagggg       480
     atggagggca aggtcgtggt ccgcgtcacc atcggccccg acgggcgcgt catcgacata       540
     gagcggctgt cggcggccga cgaggccttc tggatcgcca cgcagcgcca cgccctgcgc       600
     aaatggcgct tccgtccggc gactcgggac ggcgtgccgg tcagttcgac caaggtgctg       660
     accgtccatt tccggctggc ggacgtctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page