(data stored in SCRATCH zone)

EMBL: AP010803.TRAO

AP010803.TRAO        Location/Qualifiers
FT   CDS_pept        complement(464859..465728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traO"
FT                   /locus_tag="SJA_C1-04560"
FT                   /product="DNA transfer TraO-like protein"
FT                   /note="putative DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95290"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY58"
FT                   /protein_id="BAI95290.1"
FT                   /translation="MSAEKPESSRGARKRSNAISIGEASPSGRSEKHGPDAPEPLGKKE
FT                   KGQRPPRSVSTGDMPETLQKRYFSSTSKWSGEPAYFTTAQAKEPAFRDQGRRLVTSSDS
FT                   EEVVRDLVAIARHRGWTNVHLTGSEAFRRAAWLEANRQGLDVRGYRPNERDLQELDRLK
FT                   LGNDRNSIAPAAVPSVTRESGRDQSQAHERSARSRAAASVGRNERAAQSQLRVIEAVVR
FT                   TALFDNPEAISRVMKVATTTLQNHVDRGDQIRPALLREGRDRKGLDVAPNRNESSRVHP
FT                   PVQRSRSR"
     atgtccgctg agaaacccga gagttcgcgg ggcgctagga agcgcagcaa tgccatttca        60
     atcggtgagg catcgccatc gggccgttcc gaaaaacacg gccctgatgc tcccgaaccc       120
     ctgggaaaga aggaaaaggg gcagcggccg ccccgatcgg tctcgaccgg cgacatgccg       180
     gagacgctgc aaaaacgcta cttctcatcg accagcaaat ggtcaggcga gcctgcctac       240
     tttacgacgg ctcaggccaa ggagcctgca tttcgggacc aagggaggcg ccttgtcact       300
     tcgagtgaca gtgaggaggt cgtgcgtgat ctcgtcgcga tcgcccggca tcgtgggtgg       360
     acgaatgttc accttactgg cagcgaggcc tttcgccggg cagcatggct ggaggccaac       420
     cgccaagggc tcgacgtgcg aggatatcgg ccgaacgagc gcgatctgca ggagctggat       480
     cgcctcaagc ttggcaatga ccgcaacagc atcgcgccgg cggccgttcc gtcagtcacc       540
     cgggagtccg gccgagatca gtcccaagct cacgagcgct cggctcgatc ccgagctgcg       600
     gcgtccgtgg gcagaaacga gcgagccgcg caaagtcagt tgcgggtgat cgaagcggta       660
     gtgcgaaccg cactgttcga caatcccgaa gcgatctcgc gcgtgatgaa ggtcgcgacc       720
     accacactgc aaaaccacgt tgaccgaggt gatcaaattc gtcctgccct gctcagggaa       780
     gggcgcgaca ggaagggtct ggacgttgcg cccaaccgaa acgaatcctc gagagtccat       840
     ccacctgtgc agcgatctcg cagccggtag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page