(data stored in ACNUC7421 zone)

EMBL: AP010803.UHPA

AP010803.UHPA        Location/Qualifiers
FT   CDS_pept        499821..500444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpA"
FT                   /locus_tag="SJA_C1-04940"
FT                   /product="response regulator UhpA"
FT                   /note="two-component system, NarL family, uhpT operon
FT                   response regulator UhpA / response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95328"
FT                   /db_xref="GOA:D4YY96"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY96"
FT                   /protein_id="BAI95328.1"
FT                   /translation="MGDRRVIHLVDDEESIRKAASFALKTAGYDVVTYASGVEFLKEAK
FT                   SAAVGCVILDVRMPEMDGLEVQAAMAARGVNMPVIVLTGHGDVSVAVQAMKGGAVDFLE
FT                   KPFEKAALLGAVSRAFARLDDVDLRTLETSEAGVRVAALTPREREVLERLANGLPNKTI
FT                   AYDLGCSSRTVEVHRASLMAKLEVRNLSEALRIAFAAGMGRKPK"
     atgggggata gacgcgtcat ccatctggtc gacgacgagg agagcatccg caaggcggcg        60
     agctttgcgc tcaagaccgc gggctacgac gtcgtgacct atgcctcggg cgtggagttt       120
     ctcaaggagg cgaagtcggc ggccgtcggc tgcgtcatcc ttgacgtgcg catgcccgag       180
     atggacggtc tcgaggttca ggccgccatg gcagcacgcg gggtcaacat gccggtcatc       240
     gtcctgaccg gccatggcga cgtgtcggtt gcggtgcagg ccatgaaagg cggcgcggtc       300
     gactttctcg agaagccctt cgagaaagcg gccctgctcg gcgccgtcag ccgcgcgttc       360
     gcacgtctcg acgatgtcga ccttcgtacc ctggaaacgt ccgaagcagg ggtgcgggtc       420
     gctgcactga cgccccggga gcgggaagtg ctcgaaaggc tggcgaacgg cctgcccaac       480
     aagacgatcg cctatgacct gggctgttca tcgcgaacgg tcgaggtcca tcgcgcgagc       540
     ctgatggcca agctcgaggt ccgcaatttg tccgaagccc tgcggatcgc ctttgccgcg       600
     ggcatgggcc gcaagccgaa gtga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page