(data stored in ACNUC7421 zone)

EMBL: AP010803.YAJC

AP010803.YAJC        Location/Qualifiers
FT   CDS_pept        597581..597916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="SJA_C1-05870"
FT                   /product="preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95421"
FT                   /db_xref="GOA:D4YYI9"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI9"
FT                   /protein_id="BAI95421.1"
FT                   /translation="MFISPAFAQTAGGESSGASMLVQMAPLVLIFVVFYFLLIRPQQKK
FT                   MKEHKAKIDAVKKGDQVVTGGGLVGKVVRVDEFYADVELAPGMKVKAVKSTLTDVIDPA
FT                   TAKPAND"
     atgttcatat ctccagcctt tgcccagacc gcgggcgggg aatcctccgg cgcctccatg        60
     ctggttcaga tggccccgct ggtcctcatc ttcgtcgtct tctatttcct gctgatccgt       120
     ccgcagcaga agaagatgaa ggaacacaag gccaagatcg acgccgtgaa gaagggcgac       180
     caggtcgtga ccggcggcgg tctggtcggc aaggtggtcc gcgtcgatga attctacgcc       240
     gatgtcgaac tggcgccggg catgaaggtg aaggcggtga agtccaccct gaccgacgtg       300
     atcgaccccg ccaccgccaa gcccgcgaac gactga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page