(data stored in ACNUC7421 zone)

EMBL: AP010803.YAPH

AP010803.YAPH        Location/Qualifiers
FT   CDS_pept        complement(121742..125464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yapH"
FT                   /locus_tag="SJA_C1-01250"
FT                   /product="putative autotransporter YapH"
FT                   /note="uncharacterized protein with a C-terminal OMP (outer
FT                   membrane protein) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94959"
FT                   /db_xref="GOA:D4YX77"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX77"
FT                   /protein_id="BAI94959.1"
FT                   /translation="MRGEGRRGAIAQSVSKVGRLASDSIAALVVGGLMVLPDSAEAQPA
FT                   LRFWDGGDPAERENGVIDGGSGVWSATDPNWTDSSGTVNGPMRPVPAFTVFQGQAGTIT
FT                   IDDSNGIPAVTGMHFLTDGYRLVGGQLKLDGGAYSSIRSTAGATTRIDAQLTGNGGVFF
FT                   NDLGTVILTGANSYQGNSRVDGGTVIGNTDSIRGNLENGGTVIFDQNRDGIFAGGVSGL
FT                   FSFWGFMIKRGEGALTLGGSNNLDWRVEEGALVARAAGFGGNVEIGAAGRLTFDAGEGT
FT                   GAETIYPYALSGDGRFDVKGANMLVLTGQSTFSGRTEVADSALRVDGALGGMLHVGANG
FT                   MLSGGGQVGAVEIATGGRLTGRAGATLHMGSLALGDGSITEASFGTTQDPALFDVAGDL
FT                   TLDGTLHVANGAPLGEGLYRLISYGGQLTDRGLEIGALPPGQAADSLSIQTATVGQVNL
FT                   LSGTAARPLQFWDGGDPTRYGNGRVDGGPGVWRNGALSWTGQDGTVNEAGKANGFAIFT
FT                   GNSGQVLIDNSAGAVKTGGLQFATGGYVLSGGTLTLAGGDRTVIRVGAGSVWDSSLTAE
FT                   IAAPLSGTTTLVKRDAGTLILSGANSYTGDTEVEAGTLVGNARALRGNVRNAATLVFDQ
FT                   RENGSFSGSIRALDGNAGTMVKRGSGVLTLTGPSTLDWRLEEGRLATAASRFTGNADLR
FT                   PGAELQFAETISSRYSGRIGGSGRFIKAGGGALTLDGDSSGFTGSTQLQSGRLIVDGKL
FT                   GGQIAVEANALLSGRGTLGSVRVAPGGRIAPGPGIAKLHVEGDLTFAPGSRYEVEVDPF
FT                   GTSADAIIVTGVATLGGTVAHIGANGNYRPRSTYVILLAEGGVQGRFDAVTSTYAFLTP
FT                   TLRYGHDSVRLRLDRNDVRFSDVAASSNQQATGAALERMAAGSKVQDAVLMSDAETARK
FT                   AFDQLSGEFHASLRAALIQNSSLSRDAALDRLRATIPDRPGLTYWGQALDAWSHWRSDG
FT                   NAARFDQSSSGGLMGIEAQAPDGSFRLGMIGGHNRDRMRGQGQADVDSYHAGLYGGGTL
FT                   GRVALRGGLAFAWQDIAVQRSVRFSGFAEGVATQYRATTAQMFGETAYRIETAAGSIEP
FT                   FASIAHVRLDVGRGQESGAAAALQLEADSLRTSYATAGTRGDLDLAVGGARLAVRASAG
FT                   WQHVFGDQLPVVQAGLDGQRFAVSGLPIARDSLISELRLHGAIRDRLQINLGYRGAIAR
FT                   SGQNHQLQAGLNWQF"
     atgcgaggtg aagggcggcg cggagcgatt gcgcaatcgg tatcgaaggt aggacgactg        60
     gcgagcgaca gcatcgcggc gctggtcgtg ggcggattga tggtgctgcc cgacagtgcc       120
     gaagcgcaac cggcgctgcg cttctgggat ggcggcgatc cggccgagcg ggagaatggc       180
     gtcatcgacg gcggttcggg cgtctggagc gccaccgacc cgaactggac cgacagcagc       240
     ggcacggtga atgggccgat gcggcccgtg cccgccttca ccgtttttca gggccaggcg       300
     ggcacgataa cgatcgacga cagtaatggc ataccggcgg tcaccggcat gcattttctg       360
     acggacggct atcgcctcgt cggcgggcaa ctgaaactcg atggcggcgc ctatagctcg       420
     atccgttcga cggcgggggc gaccacgcgg atcgacgccc aactgaccgg caacggcggc       480
     gtgttcttca atgatctcgg cacggtcatc ctgaccggcg cgaacagcta tcagggcaat       540
     agccgcgtcg atggcggcac ggtgatcggc aacacggatt cgatccgcgg caatctggaa       600
     aatggcggca cggtcatctt cgatcagaat cgggacggaa tctttgccgg gggcgtcagc       660
     ggcctgttca gcttctgggg cttcatgatc aaacggggtg agggcgcgct tacccttggc       720
     ggcagcaaca atctggactg gcgcgtggag gaaggcgcac ttgtggcccg cgcggccggc       780
     tttggcggca atgtcgagat aggcgcggcg ggacggctga ccttcgacgc gggcgagggg       840
     acgggggcgg aaaccatcta tccctacgct ctttcgggcg atggccgttt cgacgtcaag       900
     ggagccaaca tgctcgtcct gaccggccag tccacctttt ccggccgaac ggaggttgcc       960
     gacagcgcgc tgcgggtcga tggcgcactg ggcggcatgc tccatgtcgg cgcgaacggc      1020
     atgttgagcg gcggcgggca ggtcggggcg gtggagatcg ccacgggcgg gcgcctgacg      1080
     ggcagggccg gcgcgacgct tcatatggga agtcttgcac ttggcgacgg ctcgatcaca      1140
     gaggccagtt tcggaacgac gcaagatccg gcgctgttcg atgtggcggg cgatctgacg      1200
     ctggacggca cgctgcatgt cgccaacggc gcgccgctgg gtgaagggct ttatcggctc      1260
     atcagctatg gcggccagct caccgacagg gggctggaga tcggtgccct gccgcccggt      1320
     caagccgccg acagcctttc gatccagacc gcaaccgtgg ggcaggtgaa tctgctttcc      1380
     ggcacggcgg cgcgcccctt gcaattctgg gacggtggcg acccgacccg ctatggcaat      1440
     ggccgggtgg acggcggccc cggcgtctgg cgcaacggcg cgctcagttg gaccgggcag      1500
     gacgggaccg tcaacgaggc cggaaaggcc aatggctttg cgatcttcac cggcaatagc      1560
     gggcaagtgc tgatcgacaa tagcgccggg gcggtaaaaa ccggcggatt gcagttcgcg      1620
     accggcggct atgtcctgtc gggaggcacg ctgacactgg cgggagggga tcgcacggtc      1680
     atccgcgtcg gcgcgggcag cgtctgggat tccagcctga ctgccgaaat cgccgcgccc      1740
     ttgtccggaa ccacgaccct ggtcaagcgc gatgcgggca cgctcatcct gtccggcgcc      1800
     aacagctaca cgggcgatac agaggtcgag gcgggcacgc tggtcggcaa cgcccgcgcg      1860
     cttcgcggca atgtccgcaa tgcggcgacg ctggtgttcg accagcggga gaatggcagt      1920
     ttctccggct cgatccgggc gctcgacggg aatgccggga cgatggtgaa aaggggcagc      1980
     ggcgtgctga cgctcaccgg ccccagcacg ctcgactggc gattggaaga ggggcggctg      2040
     gcgaccgccg cgagccgctt taccggcaat gccgacctgc ggccgggcgc ggaactccag      2100
     ttcgcggaga ccatcagcag ccgctattcc ggccggatcg gcggcagcgg gcggttcatc      2160
     aaggcgggcg gcggcgcgtt gaccctcgat ggcgattcct ccggcttcac cggcagcacc      2220
     cagcttcagt ccggacgcct gatcgtcgac ggaaagctgg gcggccagat cgcggtggag      2280
     gcgaacgcgc tgctgtccgg acgcgggaca ttggggtccg tccgggtcgc tccgggcggc      2340
     aggatcgcgc ccggccctgg gatcgcaaag cttcatgtcg agggagatct gaccttcgcg      2400
     ccgggaagcc gctatgaggt ggaggtcgat ccgttcggca cgtcggcgga tgcgatcatc      2460
     gtgaccggcg tggcgacgct cggcggcacg gtcgcccata tcggcgccaa cggcaattac      2520
     cggcccaggt ccacctatgt catcctgctc gcagaaggcg gggtgcaggg ccggttcgac      2580
     gcggtcacgt ccacctatgc cttcctgacg cctacgctgc gctatggcca tgacagcgtg      2640
     aggctgaggc tggatcgcaa tgatgtccgg ttcagcgatg tcgccgcatc ctccaaccag      2700
     caggcgaccg gcgcggcgct ggagaggatg gcggcgggca gcaaggtgca ggacgccgtg      2760
     ttgatgagcg acgccgaaac ggcgcgcaag gccttcgatc aactgtccgg tgaatttcat      2820
     gcctcgctgc gtgccgcgtt gatccagaac agcagcctgt cgcgcgatgc ggcgctggac      2880
     cgattgcgtg cgaccattcc ggaccgtccg gggctgacct attggggaca ggcgctcgac      2940
     gcctggagcc attggcgcag cgacggcaac gccgcgcggt tcgatcaaag ctcgtcgggc      3000
     gggctgatgg gcatcgaggc tcaggcaccc gacggcagct ttcgccttgg catgatcggc      3060
     gggcacaacc gcgatcgcat gaggggacag gggcaggcgg atgtggacag ctaccacgcc      3120
     gggctctatg gcggcgggac gctgggccgg gtggcgttgc gcggcggctt ggccttcgcc      3180
     tggcaggata tcgcggtcca gcggtccgtg cgcttttccg gttttgcaga gggcgtcgcc      3240
     acgcaatatc gcgcaacaac ggcgcagatg ttcggggaga ccgcctatcg catcgaaacg      3300
     gcggcgggat cgatcgagcc cttcgccagc atcgcgcatg tgcggctgga tgtcggtcgc      3360
     gggcaggaaa gcggcgcggc ggcggcgctg caactggagg cggattccct gcgcaccagc      3420
     tacgcgaccg caggcacgcg cggcgacctc gatctggcgg taggaggcgc tcggctcgcg      3480
     gtgcgcgcgt ccgcgggctg gcagcatgtg ttcggagatc aactgccggt ggttcaggct      3540
     ggccttgacg gccagcgttt cgcggtcagc ggcctgccga tcgcacgcga cagcctgatc      3600
     agcgaattgc ggttgcatgg cgcgatacgc gatcggttgc agatcaatct ggggtatcgg      3660
     ggcgcgattg cgcgtagcgg gcaaaatcat cagcttcagg caggcctgaa ctggcaattt      3720
     tga                                                                    3723
//

If you have problems or comments...

PBIL Back to PBIL home page