(data stored in ACNUC7421 zone)

EMBL: AP010803.YBEA

AP010803.YBEA        Location/Qualifiers
FT   CDS_pept        complement(271296..271718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="SJA_C1-02550"
FT                   /product="conserved hypothetical protein YbeA"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95089"
FT                   /db_xref="GOA:D4YXK7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK7"
FT                   /protein_id="BAI95089.1"
FT                   /translation="MLLHIIARGKIGRSPEAELVDRYARRLTMPFRITELPDRGGKLPP
FT                   APPGTVTVMLDEKGRQLSSIDFARRIEGWRDSGKRECRFLIGAADGFDDAERDNADLLI
FT                   AFGAMTWPHMMARAMLAEQLWRACSILAGHPYHREG"
     atgctcctcc acatcatcgc gcgcggaaag atcgggcgct cgccagaggc ggaactggtc        60
     gaccgttatg ccaggcggct gaccatgccg ttcaggatca ccgaactgcc cgatcggggc       120
     ggcaagctgc cgccggcccc gccgggcacc gtcaccgtca tgctggatga aaagggccgg       180
     cagctcagct ccatcgactt cgcccgccgc atcgagggct ggcgcgattc cggcaagcgc       240
     gaatgccgct tcctgatcgg cgctgccgac ggcttcgacg atgcggagcg ggacaatgcc       300
     gacctgctga tcgccttcgg cgcgatgaca tggccccata tgatggcccg cgccatgctg       360
     gccgagcaat tgtggcgggc ttgctccatc ctggccgggc acccctatca tcgcgagggg       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page