(data stored in ACNUC7421 zone)

EMBL: AP010803.YKVM

AP010803.YKVM        Location/Qualifiers
FT   CDS_pept        692581..693054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykvM"
FT                   /gene_synonym="queF"
FT                   /locus_tag="SJA_C1-06920"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="enzyme related to GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95526"
FT                   /db_xref="GOA:D4YYU4"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU4"
FT                   /protein_id="BAI95526.1"
FT                   /translation="MTDMPTPLQPSPIHLGQTSALPARPEDAVLDYVPNPRPGKPYLVR
FT                   FTAPEFTSLCPVTGQPDFAHLVIDYAPAATIVESKSLKLFLGAFRNHAAFHEDCTVGIG
FT                   ERLFAEMNPIWLRIGGYWYPRGGIPIDVFWQSGEPPAGLWLPPQDVPGYRGRG"
     atgactgaca tgccgactcc acttcagccg tccccgattc atttgggcca gaccagcgcc        60
     ctgcctgcgc gtccggaaga cgccgtgctg gactatgtgc ccaatccccg gccgggcaag       120
     ccctatctgg tgcgcttcac cgcgccggaa ttcacctcgc tctgcccggt gacgggacag       180
     ccggacttcg cgcatctggt gatcgactat gctcccgccg cgaccatcgt ggaatccaag       240
     tcgctgaagc tgtttctggg cgccttccgc aaccatgccg ccttccacga ggattgcacg       300
     gtcggaatcg gcgaacgcct gttcgcggag atgaacccga tctggctgcg catcggcggc       360
     tactggtatc cgcgcggcgg cattcccatc gacgtgttct ggcaatccgg cgagccgccc       420
     gcaggcctct ggctgccgcc gcaagacgtg ccgggctatc gcggccgggg gtga             474
//

If you have problems or comments...

PBIL Back to PBIL home page