(data stored in ACNUC30630 zone)

EMBL: AP010890.PE105

AP010890.PE105       Location/Qualifiers
FT   CDS_pept        complement(137382..137663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70252"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU9"
FT                   /protein_id="BAJ70252.1"
FT                   /translation="MQAGFDMDLYLDWRRDGHPNGYNLLLRNTDTPMEHEGDSSYFNAD
FT                   SGASIASFLTEYLPDELSSDADVLLSLGEPAVSGGQLTLSPQSFVVFG"
     atgcaggccg gcttcgacat ggacctctac ctcgactggc gccgggacgg ccacccgaac        60
     ggctacaacc tgttgctgcg caataccgac acgcctatgg agcacgaagg cgattccagt       120
     tatttcaacg ccgattcagg tgcctcaatc gcctcattcc tcacggaata cctgccggac       180
     gagctctctt ccgacgccga cgtgctgctc agtcttggtg aaccggccgt gagcggcggg       240
     cagctgacgc tctccccgca atcgttcgtc gtgtttggtt aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page