(data stored in ACNUC30630 zone)

EMBL: AP010890.PE114

AP010890.PE114       Location/Qualifiers
FT   CDS_pept        148666..150018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0114"
FT                   /product="xanthine/uracil transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70261"
FT                   /db_xref="GOA:E8MWV8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV8"
FT                   /protein_id="BAJ70261.1"
FT                   /translation="MSIRKELTAQNVLLGFQHVLVSNVWLDPVFVAGAIGLPIALSSNM
FT                   INAIFIVSGLVTLVQATRLVRLPVVQGPSAAFDALMIAAGTAGMLGAASSSILIASLVF
FT                   LLLCLTGVIERMRFLFSPMISGVVIFMVGVSLSGFTLSEFLGGAPGDKTFADPHILTVS
FT                   ILTTAIVLVLSLLGKGLLKSFSFLIALVVGTVVAAAFGMVDFSPVASKGWLGLPTFLPY
FT                   GPFTFDWKIFIPFFIAYMVAVMEALGVYQAASEIQGTSLERKQVRYGLAGEAAGSAISS
FT                   LIGGFTTTAYPQNVGLLNLTGEGKLRTRTPVIIAAVLLLILGFVPKAGALLSVIPSAVV
FT                   GGIFLPAAASLIVTGLRALRKVADDERRQTVIGMSLLLGIALPKALSGLTGGASVFFGN
FT                   NIMVGVFSAIILNALFVALPDLVAKHRAPASVDVPAADPADGTGAAAYDER"
     atgtcaatac gcaaggagct gaccgcccag aacgtactgc tgggtttcca gcatgtgctt        60
     gtttccaacg tctggcttga tccggtgttt gtggccggag caatcggctt acctattgcc       120
     ctgtcgtcga acatgattaa cgccatcttc atcgtctctg gtctggttac tttggttcag       180
     gccactcggc tggttcgcct gccggtggtg caggggccgt cagccgcgtt tgacgcgttg       240
     atgatcgcgg caggtacggc cggcatgctg ggggcggcga gttcgtccat tctcatcgct       300
     tcgcttgtgt tcctgttgct gtgcctgacc ggtgtgatag agcggatgcg gttcctgttc       360
     tctccgatga tttcgggcgt ggtcatcttt atggtcggtg tctcgctgtc tggattcacg       420
     ctgagcgagt ttctaggcgg ggctcccggc gacaagacgt tcgccgatcc gcacatcctg       480
     accgtgtcga ttctgaccac ggcgattgtg cttgtcctgt cgttgctcgg caagggcctg       540
     ctcaagtcgt tctcattcct catcgcgctc gtcgtcggca ccgtggtcgc cgcagcgttt       600
     ggcatggtgg acttctctcc tgtggcatcc aagggatggt tgggcctgcc gaccttcctg       660
     ccctacggtc cgttcacatt tgactggaag atcttcatcc cgttcttcat tgcctacatg       720
     gttgccgtca tggaagctct cggcgtctat caggcggctt ctgagattca gggcacgtcc       780
     ctcgaacgca agcaggtgcg ctacggtctt gccggcgagg cggccggttc agccatttcc       840
     tcgctgattg gtggattcac caccaccgcc tacccgcaaa atgtcggcct gctcaacctg       900
     accggcgaag gcaagttgcg cacgcgcacg cctgtgatca tcgccgctgt gctgttgctg       960
     attctgggct tcgtgccaaa ggcgggcgcg ttgctgtccg tcattccctc ggcagtcgtc      1020
     ggaggcattt tcctgccggc tgcggccagc ctaatcgtga ccggcctgcg cgccctgcgc      1080
     aaggtcgctg atgacgagcg ccgtcaaacg gtcatcggca tgtctctgtt gctcggcatc      1140
     gccctgccca aggcgctctc cggcctgacc ggcggcgcaa gcgtgttctt tggcaacaac      1200
     atcatggtcg gtgtattcag cgccatcatt ctcaatgcgc ttttcgtcgc tcttccggat      1260
     ttggtggcga agcatcgtgc gccggcgtcc gtggatgttc cagcagccga tccggcggat      1320
     gggactggcg ctgcggcgta cgatgaacga taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page