(data stored in ACNUC30630 zone)

EMBL: AP010890.PE119

AP010890.PE119       Location/Qualifiers
FT   CDS_pept        154454..155179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70266"
FT                   /db_xref="GOA:E8MWW3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW3"
FT                   /protein_id="BAJ70266.1"
FT                   /translation="MGFVNFIIELLKDPRAAIAGWIAMGVAPTLGFIFLIVFIETGVVF
FT                   FPFLPGDSLLFAAGVFAAPDAATGKAALPLFWLLPVVWCAPIIGDQCNYFIGHFFGRRI
FT                   IQSGKVKALTPERLAKTEGMIEKWGPLAVFLGRFFPFIRTFMPFISGISGMRWSRFTPF
FT                   SVLGGLCWSTLFTLLGYFFGNIPAVQDHFELVIVLILLVSLAPTIIGLLKAKFGKKKPA
FT                   KVTDAQLDVMEDGIKNLDK"
     atgggcttcg ttaatttcat catcgaactg ctgaaggatc cgcgtgccgc gattgccggt        60
     tggattgcca tgggcgtggc gccgaccctc ggattcatct tcctcatcgt attcatcgaa       120
     acgggcgtgg tgttcttccc gttcctgccc ggtgattcgc tgttgttcgc ggccggcgtg       180
     ttcgcagccc cggatgctgc gaccggcaag gccgcgctgc cgctgttctg gttgctgccg       240
     gtggtttggt gcgcgccgat tatcggcgac cagtgcaact acttcatcgg tcatttcttt       300
     ggccgccgta ttatccaatc cggcaaggtg aaggcgctga ctcctgagcg actggccaaa       360
     accgagggca tgattgaaaa gtggggcccg ctggctgtgt tcctaggccg cttcttcccg       420
     ttcattcgta cgttcatgcc gttcatttcc ggtatttccg gtatgcgttg gagccgtttc       480
     acgccgttct cagtgctcgg tggcctgtgc tggtccacgt tgttcacgct gctgggctac       540
     ttcttcggca acattccggc cgtgcaggat cacttcgaac tggtgatcgt gctgattctg       600
     ctggtttcgc tcgccccgac catcatcggt ctgctcaagg ccaagttcgg caagaagaag       660
     ccggccaagg tgaccgatgc tcagttggac gtcatggaag acggcatcaa gaacctcgat       720
     aagtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page