(data stored in ACNUC30630 zone)

EMBL: AP010890.PE125

AP010890.PE125       Location/Qualifiers
FT   CDS_pept        159259..159636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70272"
FT                   /db_xref="GOA:E8MWW9"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW9"
FT                   /protein_id="BAJ70272.1"
FT                   /translation="MKTMTCRWRLARLPPDLCTGSATAEFAIVLPSVIAIAGLILAIGR
FT                   VVIVSMDCQSAAAAAAREFVVTGDESSSRSIAADVAGGEPRVIIAHDGQSTSVMVECSV
FT                   LPGPLDVTPTRVTGNATAISQ"
     atgaagacca tgacatgccg gtggcggctc gccagactgc cgccagacct atgcacgggg        60
     tcggccaccg ccgaattcgc gatcgtattg cccagcgtta tcgccatcgc cgggctgata       120
     ttggcaatag gacgtgtggt catcgtttcc atggactgtc aaagtgccgc ggcagcggct       180
     gcacgcgagt ttgtggttac cggtgacgaa tcatcctcgc gcagcatagc tgcggacgtt       240
     gccgggggag agcctcgcgt catcattgcc cacgacggcc aatcgacgag tgtgatggtc       300
     gaatgttcgg tattgcctgg tccgctggat gtcactccaa cgcgggttac cggcaacgct       360
     acggcgataa gccaataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page