(data stored in ACNUC30630 zone)

EMBL: AP010890.PE153

AP010890.PE153       Location/Qualifiers
FT   CDS_pept        complement(196497..197678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70300"
FT                   /db_xref="GOA:E8MWZ7"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ7"
FT                   /protein_id="BAJ70300.1"
FT                   /translation="MSDPNNVPLPQQPEANGTPTPNPVPQYGAPAPAQPSQPAQPAYGQ
FT                   PAYGQPAPTANSYGQAVPTYGQPAPDANTYGQSAPAYGTPAPDGNPYGPVPPSYGQYAA
FT                   PTATVPLDKPYYGCSFQEAFLRFWKKYTVFRGRASRSEFWWWVLAAFGINIVLDILNTA
FT                   TDEKLGFLATIWGLATLIPTLALSVRRLHDTNKPGWWVAIFYIAMVIGLIIMIIGGGAA
FT                   LYGGFRSLGSYDYGYGSMAAGGLGAAVIGALITLAGCVVYIVFMALPSKPEGARFDDGA
FT                   AATPMPQGAYGAPYSTPVPPNFAAPNAPAPGFNQPALAYVQPAMPTPDYGQPAAPAPDY
FT                   GQVPAPQYGQPEAPAPQYGQVPPMPQNAGDESATPSEHTAPAGDNAQKPWQGQ"
     atgtctgatc ccaacaatgt gcctttgcct cagcagcctg aggccaacgg tacgcccaca        60
     cctaatcccg taccgcagta tggcgcaccg gccccggcgc agccctcaca gccggcgcag       120
     cccgcttacg gacagccggc atacggtcag cctgctccga ccgcgaactc ttatggccag       180
     gccgtaccaa cctacggtca gcccgcgccc gacgccaaca cctacggtca atccgcaccg       240
     gcgtacggca caccggcccc cgatggcaat ccttacggcc cggttccgcc gtcttacggc       300
     caatacgccg cgcccactgc cactgtgccg ctggataagc cttactacgg atgctccttc       360
     caagaagcct tcctgcgctt ctggaagaag tacacggtgt tcaggggccg cgcgtcccgc       420
     agtgaattct ggtggtgggt gctggccgct ttcggcatca atatcgtgct ggacatcctc       480
     aacaccgcca cagatgaaaa gcttggcttc ctcgccacca tttggggtct ggcgacccta       540
     atccccaccc tggcactttc cgtccgccgt ctgcatgaca cgaacaagcc tggctggtgg       600
     gttgccattt tctatatcgc gatggttatc ggccttatca tcatgattat cggcggtggt       660
     gcggcactgt acggcgggtt caggagcctt ggcagttatg actatggtta tggcagcatg       720
     gccgccggcg gtcttggcgc ggcggtcatt ggtgcgttga ttacgctggc cggctgcgtt       780
     gtctatatcg tgttcatggc tcttcccagc aagccggagg gcgcacgttt tgacgatggc       840
     gcggcggcaa cccccatgcc tcagggtgct tacggcgcac catacagcac gcctgtaccc       900
     ccgaatttcg ccgctccgaa cgcgcccgca cccggcttca accagccggc cctggcttac       960
     gtccagccgg ccatgccgac ccccgactat ggccagccgg ctgcacccgc acctgattac      1020
     ggtcaggtac cggccccgca gtacggccaa ccggaggccc cggccccaca gtacggccag      1080
     gttccgccga tgcctcaaaa cgccggcgac gaatccgcaa caccttctga gcacacggct      1140
     cccgccggcg acaatgccca gaaaccctgg caaggccagt aa                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page