(data stored in ACNUC30630 zone)

EMBL: AP010890.PE158

AP010890.PE158       Location/Qualifiers
FT   CDS_pept        complement(207566..208450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70305"
FT                   /db_xref="GOA:E8MX02"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX02"
FT                   /protein_id="BAJ70305.1"
FT                   /translation="MCKAARQLLNTAKQQRKASPTMTSHLAEAGRTLIPRKDDRYGLLS
FT                   PALVILTFVAGLVDALSYLALGHVFVANVTGNIVFLGFAFAHAQGFVWWTSALTLATFM
FT                   IGAFIGGRIIHYFGANRARHLLVSTSIQLAFVAAALVGIYLLNQFAPEPSMGGTDASAI
FT                   ARTAQPSLNFPTARHIDLHIILLIVLLAPAMGIQNSTARKLSVPDLPTTVLTMTLTGII
FT                   ADTSAHGHEQSKLGRRAIVMLALALGALTGATLQTRGHEDVILMVMIVCLIAVIVMMIP
FT                   HVHSDARWVTGKH"
     atgtgcaagg ccgcgcgcca gctattgaat accgccaaac agcaaaggaa agcctctccc        60
     accatgacct cacaccttgc cgaagcagga cgcacactga ttccccgcaa ggatgatcgg       120
     tacggtctgc tttccccagc tctggttatt ctcacgtttg tcgccggact ggtggatgcg       180
     ttaagttact tggcactcgg tcatgtattt gtggccaatg tgaccggcaa cattgtgttc       240
     cttggttttg cattcgccca cgcgcagggc ttcgtctggt ggacttcggc gctcacgctg       300
     gccacgttca tgattggtgc gttcatcggc ggacgcatta ttcattactt tggcgccaac       360
     cgcgcgcgcc atctgctggt gtccacgtca atccagctgg cttttgtggc agctgcgctc       420
     gtcggcattt atctgctcaa tcagtttgcg cctgaaccgt cgatgggtgg cactgatgct       480
     tcagccatcg cccgcacggc acagcccagt ctgaacttcc caactgctcg gcatattgat       540
     ttgcatatta ttctgctgat tgtgctgctc gcaccggcta tgggcattca gaattccact       600
     gctcgtaagc tttcggtgcc agatttgccc acgactgtgt tgacgatgac gttaactggg       660
     attatcgctg acacttcggc gcatggtcat gagcagtcca aacttggccg gcgcgcgatt       720
     gtaatgctgg ctttggcgct cggtgctttg actggagcca cgctgcagac gcgcggtcat       780
     gaggacgtta ttttgatggt gatgatcgtc tgtctgattg cggtcattgt gatgatgatc       840
     ccccatgtgc attccgatgc ccgctgggtg accggaaaac actga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page