(data stored in ACNUC30630 zone)

EMBL: AP010890.PE182

AP010890.PE182       Location/Qualifiers
FT   CDS_pept        complement(239810..241255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0182"
FT                   /product="putative multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70329"
FT                   /db_xref="GOA:E8MX26"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX26"
FT                   /protein_id="BAJ70329.1"
FT                   /translation="MRVSVPIDSSDAKATSSGDTTRRDGFGTPHAGANTNVSNGPTDAR
FT                   STNRRIMALALPTFGQLIAEPTFILIDTAIVGHIGDAALAGLSIGSTIILTAVGLCIFL
FT                   AYSTTAQVAHLLGAGRRRAGLQAGIDGLWLALSIGTVLGLGLFAAAEPLCRALGGQGEV
FT                   LEQAVTYTRAIVLGAPGMLMVYAANGIFRGLQKVRITLIAAVGGAVVNTVLDVLFVIVL
FT                   NWGIAGSGVATLVAQWFMGLFLVIPAILWSRADGASLRPRLAGIAAAGGDGLPLFIRTL
FT                   AIRAAMVTTVACAARMGTAVLAGFQAVNSSWNFAMNMLDSVGIAGQTLVATALGAGSVQ
FT                   QARRLTRATGRAGLVTGAVIGTAFAVVGLFAGHFFSPTPHIQTLIAVGMVTMGIFFPLQ
FT                   GWMMAIDGILIGARDYRYLAVTCTLTAVVYVTLILILANMVTPALTSDLMRTAVLWAAF
FT                   NVVLMGGRGLSNGLRVRSDAWMK"
     atgcgtgtga gcgtgcccat agactcttcc gacgccaaag ccaccagttc cggcgatact        60
     acacgccgcg atggcttcgg caccccgcat gccggcgcaa acacaaacgt cagcaacggc       120
     ccgaccgacg cccgctccac caaccgccgg atcatggcgc tggccctgcc gaccttcggc       180
     cagctcatcg ccgaaccgac cttcatcctt atcgacacag ccatcgtcgg ccatatcggg       240
     gatgcggcgt tggccggcct gtcaatcggc tccaccatca tcctcacggc agtcggacta       300
     tgcatattcc tggcctactc gaccactgcg caggtggcac atctgctggg agcgggtcgt       360
     cgtcgcgcgg gactgcaggc aggcattgac ggcctgtggc tggccttgag catcggcacc       420
     gtactgggat tgggattgtt cgcggctgcc gagccattat gccgggcact gggcggtcag       480
     ggcgaagtat tggaacaagc cgtgacctat acgcgcgcaa tcgtgctggg tgcgccaggc       540
     atgctgatgg tatatgcggc gaacggcatt ttccgaggat tgcagaaggt tcgtatcacg       600
     ctgatcgctg cggtgggcgg cgcggtggtg aacacggtgc ttgatgtgtt gttcgttatt       660
     gtgctgaatt ggggcattgc cggctccgga gtggcgacgc tggtagctca gtggttcatg       720
     gggctgttcc tggtaatccc cgccattctg tggtcccggg cggatggtgc gagtctgcgg       780
     cctcgtttgg ccggtattgc ggcagccggg ggcgacggac tgccattgtt cattcgcaca       840
     ttggcgattc gtgcggccat ggtgactacg gtcgcctgtg ccgcgcgcat gggcactgcc       900
     gtgttggccg ggtttcaggc cgtgaactcc tcttggaatt ttgcgatgaa catgctggat       960
     tccgtgggca tcgccggcca gacgctggtg gccacagcgc tgggcgctgg cagcgtgcag      1020
     caggcgcggc ggctgacgcg ggcgaccggg cgtgcgggac tggtcaccgg cgcggtaatc      1080
     ggcacggctt ttgcggtagt cggcctgttc gccgggcact tcttctcccc tacgccacat      1140
     attcagacgc tgatcgccgt gggcatggtg acgatgggca tcttcttccc actgcaaggc      1200
     tggatgatgg caatcgacgg cattcttatc ggcgcgcgcg actaccgcta tctggccgtc      1260
     acatgcacgc tgaccgccgt ggtgtatgtg acgctcatac tcatactggc caatatggtg      1320
     acgccggcgc tgacgagcga cctgatgcgt accgccgtac tctgggccgc gttcaacgtg      1380
     gtgctcatgg gtgggcgcgg tctgtccaac gggctgcgcg tgcgctcgga cgcatggatg      1440
     aagtag                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page