(data stored in ACNUC30630 zone)

EMBL: AP010890.PE19

AP010890.PE19        Location/Qualifiers
FT   CDS_pept        24948..25754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70166"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL3"
FT                   /protein_id="BAJ70166.1"
FT                   /translation="MPYRRRQSTAPKSGAPKSVRSAAAGQSLDIDGIHLHLTRKPIKNL
FT                   YLRIKPPSGRVEISAPMRMSESRIADFVKERHSWILAQQQRMAEAQRRSIMALNEGAGF
FT                   ENGGRGVAGASGHDGGVAGRPKTGDISRPGIGDAGPGQAGTNVQPYFDRSQIWTDERKR
FT                   QAAAAINAALPQLLAKWGPVVGRQPTHITLRVMTSRWGSCTPRTGRIRLNLQLGLMEPQ
FT                   FLEYVLVHEMTHLWESGHGAGFQRRMTAYLPGWKTLRRDLNRRVVL"
     gtgccttatc gccgtcgtca atccaccgct ccgaagtccg gtgcgccgaa atccgttcgg        60
     tccgctgccg ccgggcagtc gttggatatt gatggcatcc atctgcacct gacgcgcaaa       120
     cccatcaaaa acctgtatct gcgcatcaaa ccgccgagcg gccgcgtcga aatctccgca       180
     ccgatgcgga tgagcgagag tcgcattgcg gatttcgtca aagagcgaca ttcgtggatt       240
     ctcgcccagc agcagcgcat ggctgaggcg caacggcgct ccatcatggc attgaacgag       300
     ggcgccggct tcgagaacgg aggtcgtggt gtagctggtg ccagcggcca tgatggaggc       360
     gttgccggtc gtccgaaaac cggtgatatc agtcgtccgg gaattggtga cgccgggcca       420
     ggccaagccg gtacgaatgt ccaaccgtat tttgaccgct cccaaatctg gaccgacgaa       480
     cgcaaacgac aagcggcggc cgcgatcaac gccgcgttgc cacagctgct ggccaagtgg       540
     gggccggtcg tcggccggca gcccacgcat atcacgctac gggtcatgac ctcgcgctgg       600
     ggatcgtgta caccgcgaac cggccgcatc cgtctgaacc ttcaattggg actgatggaa       660
     ccgcaattcc tggaatacgt cttggtccat gagatgacgc atttgtggga aagcggccac       720
     ggtgccggat tccagcgccg catgaccgcc tacctacccg gctggaagac gctgcgccgc       780
     gacctcaacc gccgcgtggt gctgtga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page