(data stored in ACNUC30630 zone)

EMBL: AP010890.PE215

AP010890.PE215       Location/Qualifiers
FT   CDS_pept        285781..286095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70362"
FT                   /db_xref="InterPro:IPR019592"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX59"
FT                   /protein_id="BAJ70362.1"
FT                   /translation="MSAEDLDNYETDAELALYREYRDVIKLFTYVVETERRFYLANKVD
FT                   FNVRSAGQDVYFDVQLTDAWVWDVYRSSRFVKSVRIVTFKDVNVEEVQKTDIDIPDDIH
FT                   "
     atgagtgccg aggatctcga caattacgaa accgacgccg aactcgcgct gtatagggaa        60
     taccgtgacg tcatcaagct gttcacctat gtggtggaga ctgagcgtcg cttctacttg       120
     gcgaataagg tcgatttcaa cgtgcgttcc gctggtcagg acgtgtattt cgatgtgcag       180
     ctgactgacg catgggtatg ggatgtctac cgttccagcc gtttcgtcaa gtccgtgcgc       240
     atcgtgacct tcaaggacgt gaacgtcgaa gaagtccaga aaaccgatat cgacattccc       300
     gacgatattc actga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page