(data stored in ACNUC30630 zone)

EMBL: AP010890.PE219

AP010890.PE219       Location/Qualifiers
FT   CDS_pept        292336..292482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70366"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX63"
FT                   /protein_id="BAJ70366.1"
FT                   /translation="MPSTFTCTLTIYEMKEASLGSIVLGVGSGAAMFGDADASHILTGD
FT                   YDI"
     ttgccgtcaa cgttcacatg cacgctgacg atatatgaga tgaaagaggc atcactgggt        60
     tcgattgttt tgggagtggg cagtggtgcg gccatgttcg gcgatgcgga tgccagccat       120
     atcctcaccg gcgactatga catctga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page