(data stored in ACNUC30630 zone)

EMBL: AP010890.PE246

AP010890.PE246       Location/Qualifiers
FT   CDS_pept        323968..324357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70393"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX90"
FT                   /protein_id="BAJ70393.1"
FT                   /translation="MSEKMEAVATSEAPAALGAYSQAVKANGFVFVSGQLGIDPATGEL
FT                   AGETAGEQAAQALKNIKHILDTAGTGIEHVCRATIYLKNVEDFKEVDARYAEAFIGSVK
FT                   PARVAFGNNMIPKGALVEIDAIAVE"
     atgagcgaaa agatggaagc cgtagccact tccgaggcgc cggccgcgct gggcgcatac        60
     agtcaggcgg tgaaggccaa tggcttcgtg ttcgtatccg gccagctggg cattgatccg       120
     gccaccggcg aactggcggg cgagaccgct ggagagcagg ctgcacaggc gctgaagaat       180
     attaagcaca ttctcgacac tgccggtacc ggcattgagc atgtgtgccg cgccaccatc       240
     tacctgaaga acgtcgagga cttcaaggaa gtggacgcac gttacgctga ggcgttcatc       300
     ggctccgtca agcccgcccg cgtggccttt ggcaacaaca tgattcccaa gggtgcgctc       360
     gtggagatcg acgccatcgc ggtggagtga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page