(data stored in ACNUC30630 zone)

EMBL: AP010890.PE27

AP010890.PE27        Location/Qualifiers
FT   CDS_pept        complement(33860..35146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0027"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70174"
FT                   /db_xref="GOA:E8MWM1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM1"
FT                   /protein_id="BAJ70174.1"
FT                   /translation="MARFTENRWTSAIIPALLIHIPIGTVYCWSVFKQLIADRLHASPA
FT                   SVEWGFSLAIFFLGMSAAFAGPMVEKNIKKSALVSMVCFVVGFAGTGVSIALNFLPGVF
FT                   ICYGAIMGIGLGVGYLTPVKNLMLWFADNKGLATGIAVAGFGLAKAIASPLMEYLIGTV
FT                   GLVSMFFILAAVYAVMMFVGFLLIKRPAGWVYDPATSHVSRKTILKKPVFWGIWIAFYI
FT                   NITCGLALISQEKDILHDVLRAFPQYANLSPAKFAAAISGIIGLVLAVDSVFNTAGRVG
FT                   FSTLSDHLKRRETVYQVIFIMSIAVCLLQIFTNSIGNALLWAVLAMLFLVNAGYGGGFS
FT                   TLPVLLDQHFGTKTVSTTHGLTLSAWAFAGLSGNQLASFVVAHAPDQAHRYAALIPVLT
FT                   GLFVVALISISLVKYLGDRNVTKAVEDRG"
     atggcaaggt ttaccgagaa tcgttggacc agcgcgatta ttcccgcact gctgattcat        60
     atcccaatcg gtaccgtcta ttgctggagc gtgttcaagc agcttatcgc tgaccgtctc       120
     cacgccagcc ccgcctccgt ggaatggggc ttctcactcg ccatcttctt cctcggcatg       180
     tccgccgcgt ttgccgggcc aatggtggag aaaaacatca agaaatccgc actcgtatcc       240
     atggtctgct tcgtggtcgg cttcgccggc acgggcgtga gcatcgccct gaacttcctg       300
     ccgggcgtgt tcatctgtta tggcgcgatc atgggcatcg gcctgggcgt cggttatctg       360
     actccggtca agaacctgat gctttggttc gccgacaaca agggcctcgc caccggcatc       420
     gccgtcgccg gcttcggcct ggccaaggcc attgccagcc cactgatgga atatctcatc       480
     ggcacggttg gcctggtcag catgttcttc atcctcgccg cggtctacgc ggtgatgatg       540
     ttcgtcggct tcctgctcat caagcgtccg gccggctggg tgtacgatcc cgcgacctca       600
     cacgtcagcc gcaagacaat cctcaagaag cccgtgttct ggggcatctg gatagccttc       660
     tatatcaaca tcacctgcgg cctggccctc atcagccaag agaaggacat cctgcacgat       720
     gtgctcaggg ccttcccgca gtatgccaac ctgagccccg ccaagtttgc cgccgccatc       780
     tccggcatca tcggactggt gctcgccgtg gactccgtgt tcaacacggc tggccgcgtg       840
     ggcttctcca cactctccga ccacctgaag cgccgcgaga ccgtctatca ggtaatcttc       900
     atcatgtcga ttgccgtgtg cttgctgcag atcttcacca acagcatcgg caacgctctg       960
     ctgtgggccg tgctggccat gctgttcctc gtcaacgcgg gctatggtgg cggtttctcg      1020
     acgctgcccg tgctgcttga tcagcacttc ggcaccaaaa ccgtctccac cacgcacggt      1080
     ctgacgctga gcgcctgggc gttcgccggt ctgtccggca accagttggc ctcgttcgta      1140
     gttgcccacg cgcctgatca ggcccaccgc tacgccgcac tcatcccggt gctcaccggc      1200
     ctgttcgttg tggccctgat cagcatcagc ttggtcaagt acctcggcga cagaaacgtc      1260
     acgaaggccg tcgaagaccg aggctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page