(data stored in ACNUC30630 zone)

EMBL: AP010890.PE305

AP010890.PE305       Location/Qualifiers
FT   CDS_pept        complement(397342..397761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0305"
FT                   /product="plasmid stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70452"
FT                   /db_xref="GOA:E8MRQ8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ8"
FT                   /protein_id="BAJ70452.1"
FT                   /translation="MIILDTNVISEIIKKQPDEHVANWLRNQDTSNLATTAITVAELLA
FT                   GICRMPEGKRRKYTDTTVKLALMTLEDRTFAFDTQAAADYAHILVEREHRGTPTSIQDA
FT                   MIAAIACSWDAAIATRNIKDFEGTDVELINPWEFA"
     atgattattc tggacaccaa cgtcatcagc gaaatcatca agaaacagcc agacgaacac        60
     gttgccaatt ggctgaggaa ccaagataca agcaatttgg caaccaccgc catcaccgtc       120
     gccgagttgt tggccggaat atgtcgcatg cctgaaggca aacgacgaaa gtacacagat       180
     acgaccgtca agctggcgct tatgacatta gaggacagaa cgttcgcatt tgacactcag       240
     gcagctgcgg attatgccca tatccttgtc gaacgcgaac acaggggcac acctaccagt       300
     attcaagacg ccatgattgc ggcaattgcc tgttcctggg atgcggccat agccacgcgc       360
     aatatcaagg acttcgaagg taccgacgtg gaattgatta atccgtggga gtttgcatag       420
//

If you have problems or comments...

PBIL Back to PBIL home page