(data stored in ACNUC30630 zone)

EMBL: AP010890.PE324

AP010890.PE324       Location/Qualifiers
FT   CDS_pept        414123..415391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0324"
FT                   /product="peptidoglycan branched peptide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70471"
FT                   /db_xref="GOA:E8MRS7"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS7"
FT                   /protein_id="BAJ70471.1"
FT                   /translation="MRDFVLVKLTDEEFDDFSARHPQGNFQQTSAMGRLRTAQGIDVEY
FT                   LALKEGEKIVAAALFETHRSRFSTFAVIHDGPMCDYHDTEALTFFMDALKRHAKAKGAS
FT                   QLEITPESPYRLRDTNGASLPDDQNGAPDNKLIEQLEAIGFTHGGFTVGYTAVPRWRYL
FT                   KDLTGITDEKSLLKSYDKRTQWSVKRAQSMGVHVRELSDDELGVFARIEQQTAERRSFE
FT                   YRGEAYFHRFKEAFGIKAHFMVAEIHIDEYVADMTSKREALSAKVAALTAKNAEHPTTK
FT                   TERQLGEETRNLAAAEKRLNEAAEFAKDGDVLPAAASLFVEHPREVIYLFSGSVEQYKP
FT                   FYASALIQHDAMLHFCVEHGLSRYNFYGIDGVFDDPDDEGRGVLEFKQGFNGYVEELPG
FT                   EFVLPVKPVAYAMKQFAHKLLSR"
     atgcgtgatt ttgtgctggt gaagttgaca gacgaggagt tcgatgattt ctccgccagg        60
     catccacaag gcaatttcca acaaacctcg gcgatgggac gccttcgcac cgcgcagggg       120
     atcgacgtcg aatatttggc cctcaaggag ggcgagaaga tcgtcgcggc ggcactgttc       180
     gaaactcacc gctctcgatt ctctacattt gcggtcatcc atgatggccc gatgtgcgac       240
     tatcacgaca ccgaagcatt gaccttcttc atggatgcgc tgaaacgcca tgccaaggca       300
     aagggtgctt cacagctgga aatcacccct gaatccccgt atcggcttcg cgacaccaat       360
     ggagcttctt tgccggatga ccagaatggc gctcccgaca ataagctgat agaacagctc       420
     gaggcgatcg gcttcactca tggcggtttc accgtgggct acacggcggt tccgcgttgg       480
     cgctacctca aggatctgac cggcattacc gatgagaaaa gtctgctgaa gtcctatgac       540
     aagcgcaccc agtggagcgt gaagcgtgcc caatcgatgg gtgtgcacgt gcgtgagctg       600
     tcggacgacg agctgggggt attcgcacga atcgagcagc aaaccgctga acgccgtagc       660
     ttcgaatacc gtggcgaagc atatttccac cgtttcaagg aagcgttcgg catcaaagcg       720
     cattttatgg ttgccgagat ccacatcgac gaatacgtag cagacatgac gtccaagcgt       780
     gaagcgcttt cggccaaggt ggcggcattg accgccaaaa acgccgaaca ccccaccacc       840
     aaaaccgaac gtcagctggg ggaggagacc cgcaatctgg cggcagccga aaagcgcctg       900
     aacgaggcgg ccgagttcgc caaagacggg gatgtactgc cggctgcggc atcactattc       960
     gtggagcatc cgcgcgaggt catctacctg ttctccggta gcgtcgagca gtacaagccc      1020
     ttctacgcct ccgcgctgat tcagcatgac gcgatgctgc atttctgcgt ggaacacggg      1080
     ctgtctcgct acaacttcta cggcatcgac ggcgtctttg atgatcccga tgacgagggg      1140
     cgtggtgtac tggagttcaa gcagggcttc aacggatatg tcgaggaact tccgggcgag      1200
     ttcgtgctgc cggtcaaacc ggtcgcctat gccatgaagc aatttgcgca caagctgctg      1260
     tcgcggtaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page