(data stored in ACNUC30630 zone)

EMBL: AP010890.PE326

AP010890.PE326       Location/Qualifiers
FT   CDS_pept        416825..418105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0326"
FT                   /product="peptidoglycan branched peptide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70473"
FT                   /db_xref="GOA:E8MRS9"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS9"
FT                   /protein_id="BAJ70473.1"
FT                   /translation="MSATANRTDTTYTFGVITPEELDRLSEATSQGSFQQWSGQVRLAK
FT                   IRGHEAECVGVCDASGNLVTGCVILYLNGRFGADGSVYFGPIGISDDPALLRAITEAIC
FT                   ESARRHHAVSVACWPNVAYRLYSSDGQPDGEPNDALLAGFADAGWTHGGFHTGYDVVCQ
FT                   WMYVKDLTGITNGKELLASFGKRAQWSVKRAQSMGVHVREIGPDEFDVFADIERRTGER
FT                   RGFATRGADYFRQFKQAYGADAHFMLAEIHIAEYVADMTAKREALQAKVARLQAKYDER
FT                   PTTRIERQLGEESRNLAAADKRLAEVEGYARKGDVLPAAASMFVSHPNEVVYQYSGSLE
FT                   EYKPFYASALIQYEAMLHLCVEKGVSRYNFYGISGVFDDPNDEGRGVLEFKQGFNGYVE
FT                   QMVGKFTLPVDKFRFGVSNLAHKLLRR"
     atgagcgcga ctgcgaatcg aacagatacg acgtatacgt ttggcgtgat tacgcccgaa        60
     gagctcgacc ggctttccga agccacaagc cagggcagct tccagcaatg gtccgggcag       120
     gtccgtcttg ccaagattcg tgggcatgaa gccgaatgcg ttggcgtgtg cgacgcatcc       180
     ggcaatctgg taaccggctg cgtaattctg tacctcaatg gtcgtttcgg tgcagatggc       240
     tccgtatatt tcggccccat cggcattagc gatgatccgg ctctgctgcg ggccataacc       300
     gaggcgattt gcgaatcagc ccgtcgccac catgctgttt ccgtagcatg ctggcctaac       360
     gtcgcctacc gtctgtattc ctcggacggg cagcccgacg gcgagccgaa cgatgcacta       420
     ctggccggat tcgccgatgc cggctggacg catggcggat tccataccgg ttatgacgtg       480
     gtctgtcaat ggatgtacgt caaggatctc accggcatca ccaacggcaa ggaactgctg       540
     gcgtcattcg gcaaacgtgc tcagtggagt gtcaagcggg cgcagtcgat gggtgtgcac       600
     gttcgcgaaa tcggccccga cgaattcgac gtgttcgccg atatcgaacg gcggaccggt       660
     gaacgccgtg ggttcgcgac gcgtggcgcg gactatttcc gccagttcaa gcaggcgtat       720
     ggcgcagatg cgcatttcat gctcgcggaa atccacatcg ccgaatatgt ggcggatatg       780
     accgccaagc gcgaggcgtt gcaggccaag gtagctcgat tgcaggcgaa atacgatgaa       840
     cgtccgacca cgcgtatcga acgtcagctg ggggaggaat cacgcaatct cgcggccgcc       900
     gacaagcgtc tggctgaggt ggagggatat gccaggaagg gcgatgtgct gccggcagcg       960
     gcttcaatgt tcgtcagtca ccccaatgag gtggtctatc agtattccgg ttcgttggag      1020
     gagtacaagc cgttctacgc ctcggcgctg attcagtacg aagcaatgct gcatctgtgt      1080
     gtggagaagg gcgtgagccg ctacaacttc tacggcattt ccggcgtgtt cgacgatccg      1140
     aacgacgagg gccgcggcgt gctggaattc aagcagggct ttaacggcta cgtcgagcag      1200
     atggtaggaa aattcacgtt gccggtggat aagttccgct tcggcgtgag caatctggcg      1260
     cacaagctgc tgcgccggta g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page