(data stored in ACNUC30630 zone)

EMBL: AP010890.PE327

AP010890.PE327       Location/Qualifiers
FT   CDS_pept        complement(418188..419189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70474"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT0"
FT                   /protein_id="BAJ70474.1"
FT                   /translation="MSAILTPVGLLLIILAGYLFKRFGLFGQKDYRVLQTAEFNIVLPG
FT                   AIVYSFATNPHDISLLLISVFAFLFAFIPVVFIFLATRKRNVTDRAFLMLNGAGFNLGC
FT                   FSFPVVQSFWGAGAVVPAAMFDIGNCVMVAAGTNVLTQQLLHIQPGKTLAEQHAGSAPT
FT                   LPYEKPKDRDAKRLARRALLRTIGKSFFGSVPFDTYLLMIVLTVANVKIPDWIASITQP
FT                   LSGANALVSMLMVGMLMDLPQSKHDVKEVMAVIAWRIPFSVAFALIAWFLLPFSASIRA
FT                   VMVICALAPIAIFSTLFTDKVLGNAKLAGFSLAITAMISLVMMAVAHALMGV"
     atgtccgcca ttcttacgcc ggttggcctg ttgctgatca tcctcgccgg ctatctgttc        60
     aagcggttcg gcctgttcgg gcagaaggat tatcgcgtgc tgcaaaccgc ggaattcaac       120
     atcgtgctgc ccggtgccat cgtatactcg ttcgccacca atccgcatga catctcgctg       180
     ctgcttattt cggtattcgc attcctgttt gcttttatcc cggtcgtgtt catctttctg       240
     gccacccgca agcgcaatgt gaccgaccgc gccttcctga tgctcaacgg tgccggcttc       300
     aatctcggct gtttttcttt cccggtcgtc cagtcattct ggggtgcggg cgcggtggtg       360
     ccggctgcga tgttcgatat cggcaactgc gtgatggtgg ccgccggcac caatgtgctc       420
     acccagcaac tgctgcatat tcagcccggc aaaacacttg ccgaacaaca cgccggttcg       480
     gctcccaccc taccgtacga aaagcccaag gatcgcgacg ccaaacggct tgcccgccgc       540
     gcattgctgc gcaccatcgg caagagcttc ttcggctcgg tgccgttcga cacgtatctg       600
     ctcatgatcg tgttgaccgt cgccaacgtg aagattcccg attggatcgc ctctataacc       660
     cagccattga gcggcgccaa cgcgctggtg tcgatgctga tggtgggcat gctcatggac       720
     ctgccccaat ccaagcatga cgtgaaggaa gtcatggccg tcatcgcttg gcgtataccg       780
     ttcagcgtcg ccttcgcgtt gatcgcgtgg ttcctgctgc cgttctcggc ttcgattcgc       840
     gccgtgatgg tgatctgcgc gttggctccg atcgccattt tctccacgct gttcaccgac       900
     aaagtactcg gcaacgccaa actggccggc ttctcgctgg caatcaccgc gatgatttca       960
     ctggtgatga tggctgtggc tcacgcgctg atgggcgtgt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page