(data stored in ACNUC30630 zone)

EMBL: AP010890.PE368

AP010890.PE368       Location/Qualifiers
FT   CDS_pept        473774..474028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70515"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX1"
FT                   /protein_id="BAJ70515.1"
FT                   /translation="MGDPSLHDAPLQTHGPVFEAMPVERAQDPDAGGAMPAHGRLEADV
FT                   LLQFAGERADESVFRGSHDDPPSGTGSTHASIPPRCVAM"
     atgggcgatc catcgctcca cgacgccccg ctccagacgc acggccccgt gttcgaggca        60
     atgccggtcg aacgagcgca ggacccggac gcgggtggcg ccatgcctgc ccatggacgc       120
     cttgaagcgg atgtactcct ccaattcgcc ggcgagcggg ccgacgaatc cgtgttccgt       180
     gggtctcatg acgatccgcc ttccggcacg ggcagcacgc acgcgagcat tcccccgcgg       240
     tgcgtggcca tgtag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page