(data stored in ACNUC30630 zone)

EMBL: AP010890.PE4

AP010890.PE4         Location/Qualifiers
FT   CDS_pept        4626..5096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70151"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWJ8"
FT                   /protein_id="BAJ70151.1"
FT                   /translation="MNPPIARQLNLDETKLPAEIFERLSRRGATLKDYRRRREEAIENF
FT                   GKPGRDPAELGSVMTTIAGNGVWTANMKLAQLRNHWDQVVGQAIASHSAVADFTDGVLT
FT                   IRAESTVWATQLTYLIPQLTDTIRRNLKGLTIAEIRVTGPAAGYTRKWARRR"
     atgaacccgc cgatcgcccg ccaactcaac ctggacgaga ccaaactgcc ggccgaaata        60
     ttcgagcggc tctcccgtcg cggggcgacc ttgaaggact acagacgccg ccgtgaagag       120
     gccatcgaaa acttcggcaa accggggcgc gatccggctg aactgggcag cgtgatgacc       180
     accatcgccg gcaacggcgt ctggacggcg aatatgaagc ttgcgcaatt gcgcaaccat       240
     tgggaccaag tggtgggaca ggccatcgcc agccattcgg cagtcgccga tttcacggac       300
     ggcgtactga ccatccgtgc cgaatccacg gtctgggcca cgcagctgac ctaccttatc       360
     ccccaactta ccgataccat ccgtcgcaat ctcaaaggat tgaccatcgc cgagattcgc       420
     gtgaccggac cggccgccgg atacacgcgc aaatgggctc ggcggcggta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page