(data stored in ACNUC30630 zone)

EMBL: AP010890.PE419

AP010890.PE419       Location/Qualifiers
FT   CDS_pept        535297..538860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0422"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70566"
FT                   /db_xref="GOA:E8MS22"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS22"
FT                   /protein_id="BAJ70566.1"
FT                   /translation="MATESTTNTTTIIARADQHDIDLHKASDRVNFGSIKEPIDVPYLL
FT                   GVQTDSFDWLIGNERWKARVEEDEKNGTNTVAHTSGLDEVFNEISPIENFAQTMSLTFS
FT                   DPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQTVFMGDFPLQTPHGTFI
FT                   IGGTERVIVSQLVRSPGVYFDRQQDRTSDKEVFGAKIIPSRGAWLEFEIDKKDQPQVRV
FT                   DRKRKQSAIVFLMAIGMTKSEIAQAFKDYPLVLDALEKETLETQDEALVDLYRKIRPAD
FT                   TPTPEAGKNLLDSFYFNTKRYDLARVGRYKINRKLGVEADFNDRSLHQEDIIATIKYLV
FT                   ALHDGAATFPGKRNGEDVDLRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRE
FT                   RMTTQDAEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLSGVTNKRRLSALGPG
FT                   GLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRVNPFGFIETPYRKVV
FT                   NGHVTDEVEYMTADRDLDHVIAQANQELDENGNFVSKSALARVGEEEAVDVPVSSVDYM
FT                   DVSPRQMVSLGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPLVGTGSEWRAANDS
FT                   GDVIKSEKDGVVTYVSADLIRVMNDDGTTSSYKLAKFQRSNQTTCYNQRPIIHDGERVE
FT                   AGSVLADGPAIQKGDLALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYE
FT                   IDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELT
FT                   PEERLLRAIFGEKSREVRDTSLRVPHGETGTVIGVKEITREDAEEDGDELPNGVNQMIR
FT                   VYIAQHRKITVGDKLSGRHGNKGCISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLG
FT                   QVLELHLGWIAHSGWDISLDPNMEAEWKKLVPSGAEKAEPNTPVATPVFDGVKPEVLKG
FT                   LLSTTLPNRDGDRLVGPDGKATLFDGRTGEPYTKPISVGYMYMLKLHHLVDDKIHARST
FT                   GPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGA
FT                   IVKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVAIDMKDEDDDPASSADDLGFN
FT                   IGARPDAAAKEDQKAEEPEYQ"
     ttggctactg agtctacgac gaacaccacc accatcatcg cacgcgccga ccagcatgat        60
     attgacctgc acaaggcgtc ggatcgcgtg aacttcggtt ccatcaagga acccatcgat       120
     gtgccctacc tgctgggcgt gcagaccgac agcttcgatt ggctgatcgg caacgaacgc       180
     tggaaggcgc gcgtcgagga ggacgaaaag aacggcacta acaccgtggc ccacacctcc       240
     ggcctcgatg aggtcttcaa cgagatctct ccgatcgaga acttcgctca gaccatgagc       300
     ctgaccttct ccgatccgta cttcgaagag ccgcgtcaca ccgtgcagga atgcaaggag       360
     aaggattaca cctactccgc accgctgtac gtgaatgccg agttcgagaa cggcgacacc       420
     ggcgagatca agtcccagac cgtgttcatg ggcgatttcc cgctgcagac cccgcacggt       480
     accttcatca tcggcggcac cgagcgagtc atcgtctccc agctcgtgcg ttctccgggc       540
     gtctacttcg accgccagca ggatcgcacc tccgataagg aagtcttcgg cgcgaagatc       600
     atcccgagcc gtggtgcatg gctcgagttc gagatcgaca agaaggacca gccgcaggtg       660
     cgcgtggacc gcaagcgcaa gcagtccgcc atcgtgttcc ttatggccat cggcatgacc       720
     aagtccgaga tcgcccaggc attcaaggac tacccgctgg tgctcgatgc actcgagaag       780
     gaaaccctcg agacccagga cgaggcactc gttgacctct accgcaagat tcgtccggcc       840
     gacaccccaa cccccgaggc cggcaagaac ctgctggact ccttctactt caacaccaag       900
     cgctacgatc tggcccgtgt cggccgctac aagatcaacc gcaagctggg tgtcgaggcc       960
     gatttcaacg atcgttccct ccaccaggaa gacatcatcg ccacgatcaa gtacctggtg      1020
     gccctgcacg acggtgcggc gaccttcccg ggcaagcgca acggcgaaga cgttgacctg      1080
     cgcgtggacg tcgacgatat cgaccacttc ggcaaccgtc gtatccgcca ggtcggcgag      1140
     ctgatccaga accagctgcg taccggtctg agccgtatgg agcgcgtggt gcgcgagcgt      1200
     atgaccactc aggacgccga ggccatcacc ccacagtccc tgatcaacat ccgcccggtg      1260
     aacgccacca tcaaggagtt cttcggcact tcccagctct cccagttcat ggaccagaac      1320
     aacccgctgt ccggtgtgac gaacaagcgt cgtctttccg cactgggccc cggcggtctg      1380
     tcccgcgacc gcgcctccat ggaagtgcgc gacgtgcacc cgtcccactt cggccgtatg      1440
     tgcccgatcg agtctcctga aggcccgaac atcggtctga tcggctccct ggcgaccttc      1500
     ggccgcgtca acccgttcgg cttcatcgag accccgtacc gcaaggtcgt caacggccac      1560
     gtgaccgacg aggtcgagta catgaccgct gaccgtgatc tcgaccacgt catcgcccag      1620
     gccaaccagg aactcgacga gaacggcaac ttcgtctcca agtccgccct tgcccgagtc      1680
     ggcgaggaag aggcggtcga tgtgccggtg agctccgtgg attacatgga cgtctccccg      1740
     cgtcagatgg tctccctcgg cgcctccctg atcccgttcc tggagcatga tgagggccac      1800
     cgtgcactga tgggtaccaa catgcagcgt caggcagtgc cgctgatcga atccgagcgc      1860
     ccactggtgg gcaccggctc cgaatggcgc gccgccaacg attccggcga cgtcatcaag      1920
     tccgagaagg acggtgtggt cacctacgtg tccgccgacc tgatccgcgt gatgaacgac      1980
     gacggcacca ccagctccta caagctggcc aagttccagc gctccaacca gaccacctgc      2040
     tacaaccagc gcccgatcat ccatgatggc gagcgtgtgg aggccggctc ggtgctggcc      2100
     gatggtcctg ccatccagaa gggcgacctg gccctgggca agaacctgct catcgccttc      2160
     atgccgtgga acggctacaa ctacgaggac gccgtgatca tctcccagcg cctcgtgcag      2220
     gacgacaccc tctcctccat ccacatcgag gagtacgaga tcgacgcccg cgaaaccaag      2280
     ctgggcgccg aagagatcac ccgcgacctg ccgaacgtcg gcgaggacgc tgtggccaac      2340
     cttgacgagc gcggcatcat ccgcatcggc gccgaggtcg aggccggcga catcctggtc      2400
     ggtaaggtca ccccgaaggg cgagaccgag ctgaccccgg aggagcgcct gctgcgcgcc      2460
     atcttcggcg agaagtcccg cgaggtgcgc gacacctccc tgcgcgtgcc tcacggcgag      2520
     accggtaccg tcatcggcgt caaggagatc acccgcgagg atgccgagga ggacggcgac      2580
     gagctgccca acggcgtcaa ccagatgatc cgcgtctaca tcgcccagca ccgtaagatc      2640
     acggtgggcg acaagctctc cggccgccac ggcaacaagg gctgcatctc ccgcattctg      2700
     ccggaagagg atatgccgtt ccttgccgac ggtactccgg tcgacattat gttgaacccg      2760
     ctgggtgtgc cttcccgaat gaacctcggt caggtgctcg aactgcacct cggctggatc      2820
     gcccactccg gttgggacat ctcccttgac ccgaacatgg aagccgagtg gaagaagctg      2880
     gttccgtccg gtgccgagaa ggccgagccg aacaccccgg tcgccacccc ggtgttcgac      2940
     ggtgtcaagc ccgaggtcct gaagggcctg ctgtccacca cgctgccgaa ccgtgacggc      3000
     gaccgtctgg tcggccccga cggcaaggcc accctgttcg atggccgtac cggtgagccg      3060
     tacaccaagc cgatttccgt tggctacatg tacatgttga agctgcacca cctggtcgac      3120
     gacaagattc acgctcgttc caccggcccg tactccatga tcacccagca gccgctcggt      3180
     ggtaaggccc agttcggtgg ccagcgcttc ggcgagatgg aggtgtgggc ccttgaggcc      3240
     tacggtgccg cctacacgct gcacgagatg atgaccacca agtccgatga cgtcgacggc      3300
     cgcgtgcgcg tctacggtgc catcgtcaag ggcgataacc tgccgccggc aggcatccct      3360
     gagtcgttca aggtgctcct gaaggaaatg cagtccctgt ccctgaacgt cgaagtgctc      3420
     aacgccgaag gcgtggccat cgacatgaag gacgaggacg acgatccggc cagctccgct      3480
     gacgacctcg gcttcaacat tggcgcccgc cccgacgcgg ccgccaagga agaccagaag      3540
     gccgaagagc ccgaatacca gtga                                             3564
//

If you have problems or comments...

PBIL Back to PBIL home page