(data stored in ACNUC30630 zone)

EMBL: AP010890.PE434

AP010890.PE434       Location/Qualifiers
FT   CDS_pept        570303..572153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70581"
FT                   /db_xref="GOA:E8MS37"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS37"
FT                   /protein_id="BAJ70581.1"
FT                   /translation="MAQEQKKTSKNTNSRRRGSARGRNANGSNSRTPSRKINATRQATA
FT                   PQQDAVLIAPPKYRKGSMRITPLGGLGEIGRNMNVIEYNGHLLLIDCGVLFPEEEQPGV
FT                   DLILPDFSYIKNRLDKVDALVLTHGHEDHIGGVPYLLKLRPDIPLIGSKLTLAFVDAKC
FT                   KEHHQNPTKVEVAGREKLKVGPFDLEFVNVTHSIPDALAVYVKTPAGSLIDTGDIKLDQ
FT                   LPLDHRITDLVEFGKIGEKGVDLLMMDSTNAEVPGFVKPETSIGPALDQAFAQATRKII
FT                   VASFSSHVHRVQQVVDAAHKYGRKVVFVGRSMVRNMSIAADLGYLHIPEGTVVDLKQAN
FT                   DIQDDKLVFMCTGSQGEPMAALGRIADGNHRDIHINEFDTVILASSLIPGNEHGVYKVI
FT                   NKLVQLGAKVVNRDNAAVHVSGHCNEGELLYMYNIVKPKCAMPIHGENRHLVANGLIAV
FT                   KTGVDPQNVVLAEDGDVVDLYHGRAAVVGSVPCGYVYVDGDSVGELTDDELEKRRILGT
FT                   EGFVSAFVVVDTDNHEVVTGPKIYLNAVAEDESEFDKVRHQIVEQLNDQMMQGTRDTYK
FT                   LQQTMRRTLGSWVARQLHRKPMIVPVVADIAQDVETVETK"
     atggcacaag aacaaaagaa aacaagcaag aacacgaatt ctcgccgtcg cggttccgcg        60
     cgcggccgca acgccaacgg atccaacagc cgtacgccgt cccgtaagat caacgccacc       120
     cggcaggcca ccgcacccca gcaggatgcc gtgctgatcg ccccgccgaa gtaccgcaag       180
     ggctccatgc gcatcacgcc gctcggcggc ttgggtgaaa tcggccgcaa catgaacgtg       240
     atcgaataca acggtcacct gctgctcatc gactgcggcg tgctcttccc cgaggaggag       300
     cagccgggcg tggatctcat cctgcccgat ttcagctaca tcaagaaccg tctcgacaag       360
     gtcgacgccc tggtgctcac ccacggccac gaggaccaca tcggcggcgt gccctacctg       420
     ctcaagctgc gcccggacat cccgctgatc ggctccaagc tgaccctcgc cttcgtggac       480
     gccaagtgca aggaacacca ccagaacccc accaaggttg aggttgccgg ccgtgagaag       540
     ctcaaggtgg gtcccttcga cctcgaattc gtcaacgtca cccactccat cccggacgcc       600
     ctggccgtct atgtcaagac cccggccggc tccctgatcg acacgggcga tatcaagctc       660
     gaccagctgc cgctcgacca ccgcatcacc gacctcgtcg aattcggcaa gatcggcgaa       720
     aagggcgtgg acctgctgat gatggactcc accaacgccg aggtgcccgg cttcgtcaag       780
     cccgagacct ccatcggccc ggcccttgac caagcgttcg cccaggccac ccgcaaaatc       840
     atcgtcgcca gcttctcctc ccacgtgcac cgtgtgcagc aggtggtgga cgccgcccac       900
     aagtacggcc gcaaggtcgt gttcgtcggc cgttcgatgg tgcgcaacat gtccatcgcc       960
     gccgacctcg gctacctgca catccccgaa ggcaccgtcg tggacctgaa gcaggccaac      1020
     gacattcagg acgacaagct cgtcttcatg tgcaccggct cccagggcga accgatggcc      1080
     gcactcggcc gcatcgccga cggcaaccac cgcgatatcc acatcaacga gttcgacacc      1140
     gtgattctcg ccagctccct gattccaggc aatgagcacg gcgtctacaa ggtgatcaac      1200
     aagctcgtgc agctcggcgc caaggtcgtc aaccgcgaca acgccgccgt gcacgtgtcc      1260
     ggccactgca acgagggcga gctgctgtac atgtacaaca tcgtcaagcc caagtgcgcc      1320
     atgccgatcc acggcgaaaa ccgccatctg gtggccaacg gcctgatcgc cgtcaagacc      1380
     ggcgtggacc cgcagaacgt ggttttggcc gaagacggcg atgtggtcga cctgtaccac      1440
     ggcagggccg cggtcgtcgg ctccgtgccg tgtggttacg tgtacgtcga tggcgattcc      1500
     gtcggcgagc tgaccgatga cgagctggaa aagcgccgca ttctcggcac cgagggcttc      1560
     gtctccgcgt tcgtggtggt cgacaccgac aatcacgagg ttgtcaccgg cccgaagatc      1620
     tacctgaatg ccgtggccga ggacgaaagc gagttcgaca aggttcgtca ccagatcgtc      1680
     gaacagctca acgaccagat gatgcagggc acgcgcgaca cctacaagct gcagcagacc      1740
     atgcgccgca cgctcggcag ctgggttgcg cgccagctgc accgcaagcc gatgatcgtg      1800
     cccgtcgtgg ccgacatcgc ccaggacgtc gaaaccgtag aaaccaagta g               1851
//

If you have problems or comments...

PBIL Back to PBIL home page