(data stored in ACNUC30630 zone)

EMBL: AP010890.PE448

AP010890.PE448       Location/Qualifiers
FT   CDS_pept        587386..588327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0451"
FT                   /product="putative ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70595"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS51"
FT                   /protein_id="BAJ70595.1"
FT                   /translation="MQSTKLKSIMAIALSSAMLFATAACGTSDKADAGTDSAKGSDAAT
FT                   ITSYDVSSVEKDDTIAALLPESVTKDGKLTIGTNPSYAPAEFLDADGKTQIGYDMDLAR
FT                   AMGNIFGLETEIVSSNFDTIIPAIGSKYDLGIAAFTITKERMESVDFVSYFTAGMGYAV
FT                   ATGNPKNVDENDLCGLNVAVETGTVEEEAINKTAKQCKADGKKDITIQSSKQQTDATTA
FT                   VVTGKADVFFADSPVVGYAIAQTDGQLEQLGKDFDEVPNAIAIKKGDSQTTEAVQKAMQ
FT                   KLMDDGTYTKILQHWGVESGALDKAEINPAVE"
     atgcagtcca ccaaactgaa gtccattatg gccattgcac tgagctcggc catgctgttc        60
     gccaccgccg cttgcggcac ctccgacaag gccgatgccg gtacggattc cgccaagggc       120
     tccgatgccg ccaccatcac cagctacgat gtcagctccg tggagaagga tgacaccatc       180
     gccgcactgc tgcctgaatc cgtgaccaag gacggcaagc tcaccatcgg caccaacccc       240
     tcctacgccc cggccgaatt cctcgacgcc gacggcaaga cccagatcgg ctacgacatg       300
     gatctcgccc gcgccatggg caacatcttc ggtctcgaga ccgaaatcgt ctcctccaac       360
     ttcgatacga tcattccggc catcggctcc aagtacgatc tgggcatcgc cgcctttacc       420
     atcaccaagg agcgcatgga atccgtcgac ttcgtctcct acttcaccgc aggcatgggc       480
     tatgcagtgg ccacaggcaa ccccaagaac gtcgatgaga acgacctgtg cggtctgaac       540
     gttgccgtcg agaccggcac cgtcgaggaa gaggccatca acaagaccgc caagcagtgc       600
     aaggcggacg gcaagaaaga catcaccatc cagtcctcca agcagcagac cgacgccacc       660
     accgctgtgg tgaccggcaa ggccgacgtc ttcttcgccg attccccggt tgtcggctac       720
     gccatcgccc agaccgatgg tcagctggaa cagctcggca aggacttcga tgaagtgccg       780
     aacgccatcg ccatcaaaaa gggcgattcc cagaccaccg aagccgtgca gaaggccatg       840
     caaaagctta tggacgacgg cacctacacc aagatcctcc agcactgggg cgtcgaatcc       900
     ggcgcactgg acaaggccga aatcaacccg gccgtcgaat ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page