(data stored in ACNUC30630 zone)

EMBL: AP010890.PE46

AP010890.PE46        Location/Qualifiers
FT   CDS_pept        complement(57593..59653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0046"
FT                   /product="putative serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70193"
FT                   /db_xref="GOA:E8MWP0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP0"
FT                   /protein_id="BAJ70193.1"
FT                   /translation="MPTALAGGRYQLGQLIGRGGMAEVHVALDTRLGRTVAVKIMRADL
FT                   ANDDIFLARFRREAHAVAQMNNPNIVNIYDSGEELVSSESGDAERLPYIVMEYVKGQTL
FT                   RDIIKVNGALSQRDCEQVMLGVLNALDYSHRMGIIHRDIKPGNIMISEQGVVKVMDFGI
FT                   ARALDDSAATMTQSQGVVGTAQYLSPEQARGETVDMRSDLYSAGCVLYEMLTGRPPFTG
FT                   DSAVAIAYQHVSEVATPPSAVVPGLPKMWDSICAKAMAKDRQNRYATASEFKTDILTYM
FT                   NGGVPVAAAFNPLTDLSNMKARKEAERDLPTTPVEPHQQPTQAFNPVTGQFEQIPPANG
FT                   ANSAALQSRAQQRAAAAKAKKRKKIIIGSVIAAIVAVLVIVGIVFAMNGSGNKSSEDTV
FT                   TIPEVCNASTSKDSIELKLKASGLKMTEKQDTDSTEPEGTCTKMSPDAGSKVAKGSAVK
FT                   VWFSAGPQSTQVPDVKERSQEEARSILESAGFKVNAAVKTEDSADIAKDMVTKTDPAAG
FT                   QSVPKGTTITIYVSSGMTTVPSNLVGQSKDSVLQQYEGKFSFTVEQESSDTVEAGLITR
FT                   VSPDSGSSIAQGGFITIWVSTGKEKVAVPNITAGTDYVTAELMLKAVGLKAQVNGPTGS
FT                   TAVVVSINPGAGSQVDAGSTVTITTKAGSTGGGTGTGDGGNGTGNGGGTGE"
     atgcccaccg cattggccgg cggacgctac cagcttggcc agctcatcgg tcgtggcggc        60
     atggccgagg tccacgtggc tcttgacacc cgtctgggcc gtaccgtggc cgtgaaaatc       120
     atgcgcgccg atctggccaa cgacgacatc ttcctggccc gtttccgccg cgaagcacac       180
     gccgtggccc agatgaacaa cccgaacatc gtgaacatct acgattcggg agaagaactg       240
     gtttcttccg aaagcggcga tgccgagcgt ctgccataca tcgtcatgga atacgtcaag       300
     ggccagaccc tgcgcgacat catcaaggtc aacggcgcac tcagccagcg cgactgcgaa       360
     caggtgatgt tgggcgtgct taacgcgctc gactattcgc atcgcatggg cattatccac       420
     cgcgatatca agcccggcaa catcatgatt tccgagcagg gcgtggtcaa ggtcatggac       480
     ttcggcatcg cccgcgctct ggacgattcc gcagccacca tgacccagtc gcagggcgtg       540
     gtgggcaccg cacagtacct ttctcccgag caggcgcgcg gcgagaccgt cgacatgcgt       600
     tccgacctgt attccgccgg ctgcgtgctc tacgagatgc tcaccggccg cccgccgttt       660
     accggcgatt ccgccgtggc catcgcctac cagcatgttt ccgaagtcgc cacgccgcca       720
     tccgccgtgg tgccggggct gccgaagatg tgggattcga tctgcgccaa ggccatggcc       780
     aaggaccgcc agaatcgcta tgccacggcc tccgaattca agaccgacat cctgacctac       840
     atgaacggcg gcgtgccggt ggcggccgcg ttcaacccgt tgacggacct gtcgaatatg       900
     aaggcccgca aggaagccga acgtgatttg cccaccacgc cggtggaacc gcatcagcaa       960
     cccacccaag cattcaaccc ggtgaccggt cagttcgagc agattccacc ggccaatggt      1020
     gccaactcag cggcgttgca gtcccgtgcg cagcagcgtg cggcggcggc caaggccaag      1080
     aagcgcaaga agatcatcat cggttcggtg atcgcagcga ttgttgcagt gcttgtcatt      1140
     gtgggcatcg tgttcgccat gaacggctcc ggcaacaagt cctcggaaga caccgtcacc      1200
     atccctgagg tgtgcaacgc ttccacatcc aaggacagca tcgagctcaa actcaaggca      1260
     tcgggtttga agatgaccga aaagcaagac accgactcca ccgagccgga aggcacctgc      1320
     accaagatga gcccggacgc cggctccaag gtggccaagg gatctgccgt gaaggtgtgg      1380
     ttctccgcag gcccgcagtc cactcaggtt ccggatgtca aggaacgcag ccaggaagag      1440
     gcgcgcagca ttctggaaag cgccgggttc aaggtgaacg ccgccgtcaa aaccgaagac      1500
     agcgccgaca tcgccaagga tatggtgacg aaaaccgatc ctgccgccgg tcagtcggtt      1560
     cccaagggca ccaccatcac catatatgtt tcttccggca tgaccaccgt accgagcaat      1620
     ttggtcggtc agtcgaagga cagcgtgcta cagcagtatg agggcaagtt cagcttcact      1680
     gtggagcagg agagctccga tacggtggag gccggtctga ttacccgtgt aagccctgat      1740
     tcgggctctt ccatcgcaca gggcgggttc atcaccattt gggtgtccac gggcaaggag      1800
     aaggtcgctg tgccgaatat caccgctggc actgactacg tcaccgccga actcatgctc      1860
     aaggccgtgg gcctcaaggc tcaggtcaat ggtccaaccg gcagcaccgc tgtggtagtc      1920
     agcatcaatc ctggcgctgg cagccaggta gatgcgggat cgaccgtcac cattaccacg      1980
     aaggccggca gcactggcgg cggtaccggt accggagacg gtggcaacgg tactggcaac      2040
     gggggcggaa ccggtgagtg a                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page