(data stored in ACNUC30630 zone)

EMBL: AP010890.PE461

AP010890.PE461       Location/Qualifiers
FT   CDS_pept        603787..605130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0464"
FT                   /product="sugar ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70608"
FT                   /db_xref="GOA:E8MS64"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS64"
FT                   /protein_id="BAJ70608.1"
FT                   /translation="MKFTVAKKAIALTGAVAMLGSVAACGSDTASGKPAQDKDVTEITV
FT                   WAWEPTLTQVAKDFTKKTGIKVDLKNVGTNTKEYTQLDNAIEAGSGAPDVAQVEYYAIP
FT                   QYAIKGNLLDITDKTSGYSDFYTPGPWASVQFAGKVYGLPMDSGPMAFFYNKEVFDKAG
FT                   VDAEQIKTWDQYYDAAKKIHALGDNYYITSDTGDAGFFDSMTWLAGAKPFQTSSDGSEV
FT                   TVNLTEDKGVKTFTDFWQKLLDEGLLDTKTAGWSEDWFKGMVDGTIASLFTGAWMPANL
FT                   ANSAADGAGKWRVTQMPTADGSTTNSENGGSSLAVLASTKKADAAYQFIEYANHGDGVA
FT                   TRVAGGAFPADKASMESDSFKNTTTVKNADGEDVDYFGGQKYNEVLAQAAENVSSDYQF
FT                   LPYEVKARTIFGDYLGKSYTGDQKLTDGIAAWQKALQDYGKDQGFTVK"
     atgaagttca ccgttgctaa gaaggccatt gcacttaccg gtgcggttgc catgctgggt        60
     tccgttgccg cctgcggttc cgacaccgcc agtggcaagc cggctcaaga taaggacgtt       120
     accgaaatca ccgtgtgggc ttgggagccc acgctgaccc aggttgccaa ggacttcacc       180
     aagaagaccg gcatcaaggt cgatctcaag aacgtcggca ccaacaccaa ggaatacacc       240
     cagcttgata acgccatcga ggctggctcc ggtgctccgg acgtcgctca ggttgagtac       300
     tacgccatcc cgcagtacgc catcaagggc aacctgctgg acatcaccga caagacctcc       360
     ggctactccg acttctacac ccctggcccg tgggcttccg tgcagttcgc cggcaaggtc       420
     tacggcctgc cgatggattc cggcccaatg gccttcttct acaacaagga ggtcttcgac       480
     aaggccggtg ttgacgccga gcagatcaag acctgggatc agtactacga cgccgccaag       540
     aagattcacg ctctgggcga caactactac atcacctccg acaccggtga cgccggcttc       600
     ttcgactcca tgacctggct ggccggtgca aagccgttcc agacctcttc cgatggttcc       660
     gaagtcaccg tcaacctgac cgaggacaag ggcgtcaaga ccttcaccga cttctggcag       720
     aagctgctgg acgagggcct gctcgacacc aagaccgctg gctggtctga ggactggttc       780
     aagggcatgg tcgacggcac catcgcctcc ctgttcactg gcgcttggat gcctgccaac       840
     ctggccaact ccgctgctga cggcgctggc aagtggcgtg tgacccagat gccgaccgct       900
     gacggctcca ccaccaactc cgagaacggt ggttcttcgc tggctgtgct cgcctccacc       960
     aagaaggctg acgctgctta ccagttcatc gagtacgcca accacggcga cggcgtggcc      1020
     acccgtgtgg ccggcggtgc attcccggct gacaaggcct ccatggagtc cgactccttc      1080
     aagaacacca ccactgtgaa gaacgccgat ggcgaggacg ttgactactt cggtggtcag      1140
     aagtacaacg aggttctggc tcaggctgct gagaacgtgt cctccgacta ccagttcctg      1200
     ccctacgagg tcaaggcccg caccatcttc ggcgactacc ttggcaagtc ctacaccggc      1260
     gaccagaagc tgactgacgg tatcgccgct tggcagaagg cactgcagga ttacggcaag      1320
     gatcagggct tcaccgtgaa gtaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page