(data stored in ACNUC30630 zone)

EMBL: AP010890.PE474

AP010890.PE474       Location/Qualifiers
FT   CDS_pept        620316..620858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70621"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS77"
FT                   /protein_id="BAJ70621.1"
FT                   /translation="MTQSNAANKATGRRFRHATMRDLPQMQKIYARARALMAANGNPTQ
FT                   WGNEFPRESMIEDDIANQRTMLLVDTCNGHERILAQFALCPGEDPTYAKIDGAWLDNDA
FT                   YVTIHRIAASGLVRHAARDCIRWALKHYGNVRADTHPNNKAMQHVLESSGFARCGLIQL
FT                   LDRPVDTTRIAYQRHEW"
     gtgactcagt cgaacgctgc aaacaaggcg acaggccgcc gtttccgcca cgccaccatg        60
     cgcgatctgc cgcagatgca gaaaatctac gcacgcgcac gcgcgttgat ggccgccaac       120
     ggcaacccca cccagtgggg caacgaattt ccgcgtgaat cgatgattga ggacgacatc       180
     gccaaccagc gtacgatgct gctggtcgac acctgcaatg gccacgaacg cattctggcc       240
     cagttcgccc tgtgcccggg cgaggatccg acctacgcca aaatcgacgg cgcctggctg       300
     gacaacgacg cctatgtgac catccaccgc atcgccgcat ccggtctggt gcgccacgcg       360
     gcccgcgact gtatcaggtg ggccctgaag cactacggca acgtgcgcgc cgacacccac       420
     cccaataaca aggccatgca gcacgtgctc gaaagctccg gcttcgcccg ttgcggcctg       480
     atccagctgc tcgaccggcc ggtcgacacc accagaatcg cctatcagcg ccacgagtgg       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page