(data stored in ACNUC30630 zone)

EMBL: AP010890.PE481

AP010890.PE481       Location/Qualifiers
FT   CDS_pept        630389..631264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70628"
FT                   /db_xref="GOA:E8MS84"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS84"
FT                   /protein_id="BAJ70628.1"
FT                   /translation="MTQNRAELNRNLAQMLKGGVIMDVTTPEQAKIAQDAGACAVMALE
FT                   RIPADIRAAGGVSRMSDPAMIKGIQEAVSIPVMAKVRIGHIAEARILQAIEIDYIDESE
FT                   VLSPADDVYHIDKNQFDVPFVCGAKNLGEALRRIAEGAAMIRTKGEPGTGDVIQAVRHM
FT                   RTMNKQIRELVGLRDDEVYEAAKQLAVPYDLAKYVHDNGRLPVVNFAAGGVATPADAAL
FT                   MMELGAEGVFVGSGIFKSGDPAKRAAAIVKATANWQDADLLAKLSENLGEAMVGINEDE
FT                   IQTIMAARGE"
     atgacgcaga atcgtgcgga actcaaccgt aatttggccc agatgctcaa gggcggcgtg        60
     atcatggacg tcaccacgcc cgagcaggcg aagatcgctc aggacgctgg tgcctgcgcg       120
     gtgatggcgc tcgagcgcat ccccgccgac atccgtgccg ccggcggcgt ttcccgcatg       180
     agcgacccgg ccatgatcaa gggcatccag gaagccgtgt ccattccggt tatggccaag       240
     gtgcgtatcg gacacatcgc cgaggcccgc attctgcagg ccatcgaaat cgattacatc       300
     gacgaatccg aggtgctttc cccggccgac gacgtgtacc acatcgacaa gaaccagttc       360
     gatgtgccgt ttgtgtgcgg tgcgaagaac ctgggcgagg cgctgcgccg catcgccgag       420
     ggtgcagcca tgattcgcac caagggcgag cccggcaccg gcgacgtgat tcaggccgtg       480
     cgccacatgc gcaccatgaa caagcagatc cgcgaacttg tcggcctgcg cgacgacgag       540
     gtctacgagg ccgccaagca gctggccgtg ccctacgatc tggccaagta cgtgcacgac       600
     aacggccgtc tgcccgtcgt gaacttcgcc gccggtggtg tggccacccc ggccgacgcc       660
     gccctgatga tggaactcgg tgccgaaggc gtgttcgtgg gctccggtat cttcaagtcc       720
     ggcgatccgg ccaagcgcgc cgccgccatc gtcaaggcca ccgccaactg gcaggacgcc       780
     gatctgctcg ccaagctgtc cgaaaaccta ggcgaagcca tggtcggtat caacgaggac       840
     gagattcaga ccatcatggc cgctcgcgga gagtga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page