(data stored in ACNUC30630 zone)

EMBL: AP010890.PE485

AP010890.PE485       Location/Qualifiers
FT   CDS_pept        634815..634949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70632"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS88"
FT                   /protein_id="BAJ70632.1"
FT                   /translation="MAGVLRILGKESAAHRPFMYAASAADQCGSARYLVIVLYVGMFV"
     atggccggtg tgctgcggat tcttggtaag gaatccgcag cacaccggcc attcatgtat        60
     gcggcaagtg ccgccgatca gtgcggcagt gcgcgctact tggtgatcgt gttgtacgtg       120
     ggcatgttcg tgtaa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page