(data stored in ACNUC30630 zone)

EMBL: AP010890.PE49

AP010890.PE49        Location/Qualifiers
FT   CDS_pept        complement(62072..63733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0049"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70196"
FT                   /db_xref="GOA:E8MWP3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP3"
FT                   /protein_id="BAJ70196.1"
FT                   /translation="MIVTRLRQISLLLIAMAISALAFIQMFQRTAGEFPMQYAGMLALA
FT                   VVLFLVLWGLIVRFQPYASQSILPCVLLLTATGVTMIARIDQSEGWAVAQRQLIWLCIA
FT                   IVLSALLIIFLKDYRVLRRFSYVSMVVGLVLLLAPMLPFVGQEVNGARIWIRIPGLGQF
FT                   QPGEFAKLFLAFFFAAYLFDHRDQLAVGGKKMLGLQLPRIKDLGPIIVVWIASMGVLIM
FT                   QHDLGTSLMFFAMFVAMLYTATGRKSWIIIGLIAFAAGAVLAAGMFSHVGQRVDAWLHP
FT                   FSNEQYNKTPGGSWQLVTGIFGLASGGMLGTGLGQGHPSLVTFANSDFIYASLGEELGL
FT                   MGVLAILMLYLLIIASGFITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTG
FT                   LTLPYMAAGGSSLIANYILATLLIIISNSANAPEPELTSDTFQYEALAVLRNKELEARA
FT                   RATEPIVQPRSASATASQSESESFDDPIVDITKHAPDTLEAPEVPAIVTSAGSAAAPIA
FT                   EPIVDATTPAYAGADEPYTPTGTIPPLPPVNGGTRV"
     atgatcgtta cccgtctacg tcagatttct ttgttgctga ttgccatggc aatcagtgcg        60
     ttggcgttca tccagatgtt ccagcgcacc gccggcgaat tccctatgca atacgccggc       120
     atgctggcat tggccgtagt gctgtttctg gtgctgtggg ggctgattgt gcgcttccag       180
     ccgtacgcca gccagtcgat tctgccttgc gtgctactgc tgaccgccac cggcgtgacc       240
     atgatcgctc gcattgacca gagcgaaggt tgggcggttg cccaacgtca gctgatctgg       300
     ctgtgcatcg ccatcgtgct ttccgcgctg ctcatcatct tcctgaagga ctaccgcgtg       360
     ctgcggcgct tctcctacgt gtcgatggtg gtgggcttgg tgctgctgct cgccccgatg       420
     ctgccgtttg tcggtcagga agtgaacggc gcgcgcattt ggatcaggat tccgggactg       480
     ggccagttcc agccgggcga gttcgccaag ctgttccttg cgttcttctt cgccgcctac       540
     ctgttcgacc atcgcgacca gctggccgtg ggcggtaaga agatgctcgg tctgcagctg       600
     ccgcgtatca aggatctcgg cccgatcatc gtggtgtgga tcgcctcgat gggcgtgctc       660
     atcatgcagc atgatctggg cacctcgctt atgttcttcg ccatgttcgt ggccatgctg       720
     tacacggcca ccggccgtaa aagctggatc atcatcggtc tgatcgcgtt cgccgcgggt       780
     gccgtgctgg ccgcaggcat gttcagccac gtgggtcagc gagtcgatgc ctggctgcac       840
     ccgttcagca acgagcaata caacaagacc cccggcggct cctggcagct ggtcaccggc       900
     attttcggcc tggcatcagg cggcatgctc ggcaccggtc tcggccaagg ccatccttcg       960
     ctcgttacgt ttgcgaactc cgatttcatc tacgcctctc tgggcgagga actcggtctg      1020
     atgggcgtcc tggccatttt gatgctctac ctgctcatca ttgcctccgg ctttatcacc      1080
     gccatgaaaa tcaaggatgg cttcggcaag ctgctcgctt ccggactggt gttcaccatg      1140
     gccttccagg tgttcaccgt ggtcggcggc atcacgctgg tgattcctct gaccggtctg      1200
     accctgccct atatggcggc cggtggctcc agtctgatcg ccaactatat tctcgcgacc      1260
     ctgctcatca tcatctcgaa ttcggccaat gcgcccgagc cggagctgac ctcggatacg      1320
     ttccagtacg aggctttggc cgtgctgcgc aacaaggaac ttgaggcccg ggcccgcgcc      1380
     actgagccga tcgttcagcc tcgcagcgcg tcggctacgg cgtcgcagtc cgagtcggaa      1440
     tcgtttgacg accccattgt ggacatcacc aagcacgcgc cagacacact tgaggcaccc      1500
     gaagtgcccg caattgtgac ctctgcgggc tctgctgcgg cccccatcgc cgagcccatt      1560
     gtggatgcca ccactccggc gtatgccggc gccgatgaac cgtacacgcc taccggtacg      1620
     attcccccgc ttcctcccgt taacggaggc actcgcgtat ga                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page