(data stored in ACNUC30630 zone)

EMBL: AP010890.PE496

AP010890.PE496       Location/Qualifiers
FT   CDS_pept        648932..649432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0499"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70643"
FT                   /db_xref="GOA:E8MS99"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS99"
FT                   /protein_id="BAJ70643.1"
FT                   /translation="MANESKPEVAVVMGSSSDWETMKRACDILDQFGVVYHKQVISAHR
FT                   TPELMAEFAHNARANGLKVIIAGAGGAAHLPGMIAAQTTLPVIGVPVRSHALSGWDSLL
FT                   SIVQMPGGIPVATTAVGNSGATNAGLLAVQMLSAFEPELADKLEDYRNELKEKVAESNA
FT                   QLV"
     atggcaaatg aatccaagcc cgaagtcgcg gtggtcatgg gatcctccag cgactgggag        60
     accatgaagc gtgcctgcga tattctcgac cagttcggtg tcgtctacca caagcaggtc       120
     atttccgcgc accgcacgcc cgagctcatg gccgagttcg cgcacaacgc ccgcgccaat       180
     ggcctgaagg tcattatcgc cggtgccggc ggtgccgccc acctgccggg catgatcgcc       240
     gcgcagacca cactgcccgt gatcggcgtg cccgtgcgct cccacgccct gtccggctgg       300
     gattcgctgc tgtccatcgt gcagatgcct ggcggcattc cggtggccac caccgccgtc       360
     ggcaactccg gtgccaccaa cgccggcctg ctcgccgtgc agatgctctc cgccttcgag       420
     ccggaactgg ccgacaagct tgaggattac cgtaacgaac tgaaggaaaa ggtggccgaa       480
     tccaatgccc agcttgtctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page