(data stored in ACNUC30630 zone)

EMBL: AP010890.PE499

AP010890.PE499       Location/Qualifiers
FT   CDS_pept        complement(651066..651281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70646"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA2"
FT                   /protein_id="BAJ70646.1"
FT                   /translation="MFMTSGGYKHVFGEQHQSNAYMVRLKNHETSNVESRSAKLMKLDG
FT                   VKGIVQNTTSKKQHARRAEVSGIAAE"
     atgttcatga cttcgggtgg ctataagcac gtgttcggcg agcagcacca gtcgaacgcc        60
     tatatggtgc ggctcaagaa ccacgagacc tccaatgtgg agtcgcgcag cgccaagctc       120
     atgaagctgg acggcgtgaa aggcatcgtg cagaacacga cctcaaagaa acagcatgct       180
     cggcgcgctg aagtcagtgg aatagcagcg gaataa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page