(data stored in ACNUC30630 zone)

EMBL: AP010890.PE507

AP010890.PE507       Location/Qualifiers
FT   CDS_pept        complement(662071..663006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0510"
FT                   /product="amino acid ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70654"
FT                   /db_xref="GOA:E8MSB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB0"
FT                   /protein_id="BAJ70654.1"
FT                   /translation="MAPGHPGIQEASDIHHMTAAPTETRQHNAPDGHEVSQVELERRQY
FT                   RVHQQIQSTITSLISTIVFVVVIVIGLKLSPGWPRVKETFFSGEYFVKSFPHVLDGLWL
FT                   NIRVLLVAVVGVAILSTLIALVRTSRSPILFPLRILALIYTTVMRGVPIIVVLYLIGFG
FT                   IPGLGLFGRIDPSVLGTIAVVMGYSAYVSEVLRAGFNDVHPSQRASARSLGLTSGQTTR
FT                   LIVIPQALRKVAPALMNDFISMQKDVGLISVLGAVDAVRAAQIDVASTYNFTPYVVASL
FT                   LFILMSVPFILLNDWYTERLRKRELSGGTV"
     gtggcacccg gccatcccgg cattcaggaa gcgagcgaca ttcatcacat gaccgcagca        60
     ccaaccgaaa ccaggcagca caatgcccct gacggacacg aggtaagtca ggtcgagctc       120
     gaacgacgcc aatatcgtgt tcatcagcaa attcaatcga cgattaccag tctgatcagc       180
     accattgtgt tcgtggtggt catcgtcatc ggcttgaagc tctcccccgg ctggccacga       240
     gtcaaggaga ccttcttctc cggcgaatac ttcgtcaaat cgtttcccca tgtgcttgac       300
     ggcctatggc tcaacatccg cgttctgctc gtcgcagtgg tcggcgtggc gattctgagc       360
     acgctgatcg cgctggtgcg caccagccgc tcccctattc tgttcccgct gcgtatcctg       420
     gcattgatct acacgactgt gatgcgcggc gtgcctatta tcgtcgtgct gtatctaatc       480
     ggtttcggca ttcccggcct aggcttgttc ggccgtatcg atccctcggt actcggcacc       540
     attgcagtgg taatgggata cagcgcctac gtctccgagg tgctgcgtgc cggttttaac       600
     gacgtacatc cttctcagcg agcctcggcc cgctcgttgg gcctgacctc cggccagacg       660
     acccgactga tcgtcattcc tcaggcattg cgcaaagtgg cgcccgcact gatgaatgac       720
     ttcatctcca tgcaaaagga cgtcggcctg atttccgtgc tgggtgcggt ggatgccgtg       780
     cgcgccgcac agatcgacgt ggccagcacc tacaacttca cgccgtatgt ggtcgccagc       840
     ctgctgttca tcctgatgag cgtgccgttc atcctgctga acgactggta cacggaacgt       900
     ctgcgtaagc gcgaactcag cggaggaacg gtatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page