(data stored in ACNUC30630 zone)

EMBL: AP010890.PE508

AP010890.PE508       Location/Qualifiers
FT   CDS_pept        complement(663068..663931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0511"
FT                   /product="amino acid ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70655"
FT                   /db_xref="GOA:E8MSB1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB1"
FT                   /protein_id="BAJ70655.1"
FT                   /translation="MFNKRHIVRTIAATVSILALSFTAACGSGQSTASNSTDSDDITQQ
FT                   TYKPGKLTIATGQPAYEPWVMNDKPESGEGYEAAVAYAVADKLGFKKSDVVWTRTAFDT
FT                   AIAPGAKDWDFNIQQFGITDERKKAVDFSSSYYNDSQSVVVKKDSKFANATKVSDLKDA
FT                   TVGVMVGTLAYDYAKANIKDDIQTFNDDAALAQALDAGQIDALVTSTVECVYMVQSEQV
FT                   KDAKVLGRLPDSEDKSGMGIVLPKDSKLTAAVTKAVDDLNADGTIKKLQDKWLAEYTTD
FT                   LTELKK"
     atgttcaata agcgacacat cgtccgtacc attgcggcca ccgtcagcat cctggctctg        60
     tcgttcaccg cagcctgcgg ttccggccag tccaccgcat ccaattccac cgattcggac       120
     gacatcaccc agcagacgta caagccgggc aagctgacca tcgccaccgg acagccggcc       180
     tacgagccgt gggttatgaa cgacaagccg gaaagcggtg agggctacga ggcggccgtc       240
     gcctacgcag tggccgacaa gctcggtttc aagaagagcg acgtggtgtg gacccgcacc       300
     gcattcgaca ccgccatcgc tcccggcgcc aaggactggg atttcaacat ccagcagttc       360
     ggcatcaccg acgagcgcaa gaaggccgtt gacttctcgt ccagctacta caacgacagc       420
     cagtccgtcg tggtcaagaa agacagcaag ttcgccaacg ccaccaaggt atccgatctg       480
     aaggatgcga ccgtgggcgt catggtcggc acccttgcct acgactacgc caaggcgaac       540
     atcaaggacg acatccagac gttcaatgat gatgccgcac tggctcaggc acttgacgcc       600
     ggtcagatcg acgcactggt caccagcacc gtggaatgcg tgtacatggt gcagtccgag       660
     caggtcaagg acgccaaggt gctcggccgt ctgcctgact ccgaagacaa gagcggcatg       720
     ggcatcgtgc tgccgaagga ttccaagctg actgcagccg tgaccaaggc agtggatgac       780
     ctgaacgccg acggcaccat caagaagctt caggacaagt ggctggccga gtacaccacc       840
     gacctgaccg aactgaagaa gtaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page